(data stored in ACNUC1104 zone)

EMBL: CP001966.PE141

CP001966.PE141       Location/Qualifiers
FT   CDS_pept        146387..147922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0141"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sav:SAVP032 QacA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76795"
FT                   /db_xref="GOA:D5UQ27"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ27"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76795.1"
FT                   /translation="MTDLRTDHPSTMPFARRWASAAVLSISLLVITVDLTILNIALPDL
FT                   SADLRPTAAQQLWIIDAYSLVLAGLLVSTASLGDRFGRKRMLLLGYAVFGVASLLVLWA
FT                   DSPGEVIALRALLGVGGAMIMPTTLSMLRVIFTDPAERAKALGLWAAVSGLGAAIGPIA
FT                   GGVLLENFSWRAAFLVNVPFMAAVLIAGLLILPESTVPSPGRWDYVGALLSITGMVALV
FT                   WSIKRFAKDHTFASTPALVALLLAVIALSLFVYRSLHRPDPLLDVRLFERRQFTAAILA
FT                   ALGVMFAMAAALLLLAQWMQLVENYSPIETGVRLLPVAVAATVASIAAPWLARKLNARI
FT                   VLAGGLALAGIGMVLIDAADQLTYTAMIAPLVLVGMGMGSMTVASAMVMSGTPEEKAGN
FT                   AAALEETSYDLGNVLGVAVLGSIAAMLYTADADFAAIPGVDAATADAAGESLGAAMAIA
FT                   QQAQLPALAEHAAAGFTESLQTTGLVGGVLLLAVAAGVYLLTPKGTDITVQAH"
     atgaccgatc tcagaaccga tcacccgtcc acgatgccct tcgcgcggcg gtgggcctct        60
     gcggcggtgc tctcgatcag cctgctggtg atcaccgtgg atctcacgat cctcaacatc       120
     gcgctgcccg acctctccgc ggacctgcgc cccaccgcgg cgcaacagct gtggatcatc       180
     gacgcgtact cattggtgct ggccggcctg ctggtctcga ccgcctcgct cggagaccgg       240
     ttcggccgca agcgaatgct tctgctgggc tacgccgtct tcggcgtggc ctcgctactc       300
     gtgctgtggg cggattcgcc cggagaggtg atcgcgctgc gcgcgctgct gggtgtgggc       360
     ggcgcgatga tcatgcccac cacgctgtcc atgctgcggg tgatcttcac cgatcccgcc       420
     gagcgggcga aggcgctcgg cctgtgggcc gcggtctccg gcctgggcgc cgcgatcggt       480
     ccgatcgcgg gcggtgttct gctggagaat ttctcgtggc gtgccgcctt cctggtgaac       540
     gtgccgttca tggcggctgt gctgatcgcc ggcctgctga tcctgcccga gtcgacggtg       600
     cccagcccgg gccgctggga ctacgtgggc gcgctgctct cgatcaccgg catggtggcc       660
     ctggtgtggt cgatcaagcg gttcgccaag gaccacacct tcgcatcgac gccggcccta       720
     gtggcgctgc tgctcgcggt gatcgcgttg tcgctcttcg tctaccgctc gttgcaccgc       780
     ccggatccgc tgctcgacgt tcggctcttc gaacgtcgcc agttcaccgc cgcgattctc       840
     gccgcgctgg gtgtcatgtt cgccatggcc gccgcgctcc tgctactggc gcagtggatg       900
     caactggtgg agaactactc gccgatcgag accggcgtcc ggctgctccc ggtggcggtc       960
     gcggccaccg tcgcgtcgat cgccgctccc tggctcgctc gtaagctgaa cgcgcggatc      1020
     gtgctcgcgg gtgggcttgc tctggccggc atcggcatgg tgctgatcga cgccgcggac      1080
     cagctcacgt acaccgcgat gatcgcgcca ttggtgctgg tgggcatggg catgggatcg      1140
     atgacggtgg cctccgcgat ggtcatgtcg ggcactcccg aggagaaggc gggtaatgcc      1200
     gccgcactcg aagagacctc gtacgacctc ggcaacgtac tgggtgtcgc ggttctcggc      1260
     agcatcgccg cgatgctgta caccgccgac gccgatttcg cggcgatccc cggtgtggat      1320
     gcggcgaccg ccgatgccgc cggcgaatcg ctcggtgcgg caatggctat cgcgcagcag      1380
     gcgcagctgc cggcgctggc agaacacgcc gctgccgggt tcaccgagtc gctgcagacc      1440
     acgggtctgg tgggcggggt gctgctactg gccgtggctg cgggggtcta cctgctcacg      1500
     ccgaaaggca cggacatcac cgtgcaggcg cactga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page