(data stored in ACNUC1104 zone)

EMBL: CP001966.PE148

CP001966.PE148       Location/Qualifiers
FT   CDS_pept        complement(152156..153244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_39180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76802"
FT                   /db_xref="GOA:D5UQ34"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ34"
FT                   /inference="similar to AA sequence:KEGG:ROP_39180"
FT                   /protein_id="ADG76802.1"
FT                   /translation="MADDTDTQPEPVQPPDGPDRLASDDAAAAKPDPLAGPVDADVTDL
FT                   RAGRVSAANLRAVLIAVIVGALALGGTLYAAGYFDPVSEDHGPRLAANGSTLARSKPGS
FT                   CITWDTAGALAAVDCSASHKFEVAGEPANTLPPDAKYPSEQQIAALREQVCTPVVAEYL
FT                   GQRLDPKGRYQMGLLTAGEKAWEGGDRTMRCGVQLVDGSGAVVDSTGKVANQDKATSWP
FT                   VGTCIGINDRGQATVPVDCSAPHAFEVTATVDLRQKFPDASWPTLAQQEDYLGGTCPAR
FT                   TTAWFGAQDGLRKSGLQLQWNTLSQEAWTAGARTSVCFVAASDGKKFIPVTGSAKSPNL
FT                   LIDGKKPVMPTFPGAAPPKPGR"
     atggccgacg acaccgatac ccagcccgag cccgtccagc ccccggacgg gccggatcgt        60
     ctggcttccg acgacgccgc tgccgcgaag cccgatccgc tggcgggtcc ggtcgacgcc       120
     gacgtgaccg acctgcgggc aggacgggtg agcgcggcga acctgcgcgc cgtcctgatc       180
     gctgtgatcg tgggagccct cgcgctcggt ggcacgctgt acgcggccgg ctacttcgac       240
     ccggtctccg aagaccacgg gccgcgactc gccgccaacg gctcaaccct cgcacgatcg       300
     aagccgggat cctgcatcac ctgggacacc gccggcgcac tggcggccgt cgactgctcg       360
     gcgtcgcaca agttcgaagt cgccggcgag ccggccaata ccctgccacc ggacgcgaag       420
     tacccgtcgg agcagcagat cgcggcgctc cgcgagcagg tctgcacccc cgtggtcgcc       480
     gagtacctgg ggcaacgcct ggacccgaag ggccgctacc agatgggcct gctcaccgcg       540
     ggcgagaagg cctgggaggg cggcgaccgc accatgcgct gcggtgtcca actggtcgac       600
     ggctccggag ccgtcgtcga ctccaccggc aaggtggcca accaggacaa ggccacctcc       660
     tggccggtgg gcacgtgcat cggtatcaac gaccgcggcc aagccaccgt ccccgtcgat       720
     tgcagcgccc cgcacgcctt cgaggtgacc gccaccgtgg acctgcggca gaagttcccg       780
     gatgcgtcct ggccgacgct cgcgcagcag gaggactacc tgggcggcac ttgcccggcc       840
     cgcaccaccg cgtggttcgg tgcgcaggac ggcctgcgca aatccggcct gcagttgcag       900
     tggaacaccc tctcgcaaga ggcgtggacc gcgggcgcgc gcacctcggt gtgcttcgtc       960
     gccgcgtccg acgggaagaa gttcatcccg gtcacgggct ccgcgaaatc gccgaacctg      1020
     ttgatcgacg gaaagaagcc cgtcatgccc accttcccgg gtgccgctcc gccgaagccg      1080
     gggcgctaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page