(data stored in ACNUC1104 zone)

EMBL: CP001966.PE149

CP001966.PE149       Location/Qualifiers
FT   CDS_pept        153319..154572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0149"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: mab:MAB_0153
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76803"
FT                   /db_xref="GOA:D5UQ35"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ35"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADG76803.1"
FT                   /translation="MIDVKLLRENPDLVRASQRARGEDAALVDALLEADAHRRAAVLAA
FT                   DNLRAEHKTSSKSIGKAAPEERPALVAAAGELAAKVKEAEAEQARADEVFDETARKIGN
FT                   VIIEGVPAGGEDDFEVLEHVGTIPEITDPKDHLELAEGLGLLDMERGAKVSGSRFYFMT
FT                   GHGALFQMALLQLAVQKAVAHGFTLMIPPVLVKPEIMGGTGFLGAHADEIYRLEADDLY
FT                   LVGTSEVPLAGYHMGEIIDLNDGPIRYAAQSSCFRREAGSYGKDTRGIIRVHQFDKIEM
FT                   FVYCKPEDAEAEHQRLLDFEKEMLAAVEVPYRVIDVAAGDLGSSAARKFDCEAWVPSQE
FT                   RYRELTSTSNCTTFQARRLGVRYRDEDGRPQIAATLNGTLATTRWLVAIWENHQQPDGS
FT                   VRVPAALQPFLGTDVLRP"
     gtgatcgacg tcaagctgct ccgcgagaat ccggacctcg tgcgcgcctc gcagcgcgcc        60
     cgtggtgaag acgccgcgtt ggtggacgcc ctgctggagg ccgacgcgca ccgtcgcgcc       120
     gctgtcctgg cggccgacaa cctgcgtgcc gagcacaaga cgtcctccaa gtcgatcggc       180
     aaagccgcac ccgaggagcg ccccgcgctc gtcgcggcgg ccggcgagct ggcggcgaag       240
     gtcaaggagg cggaggccga gcaggctcgc gccgacgaag tcttcgacga gacggcacgc       300
     aagatcggca atgtgatcat cgagggcgtg cccgccggcg gcgaggacga tttcgaggtg       360
     ctcgagcacg tgggcacgat ccccgagatc accgacccca aagaccatct cgagctcgcc       420
     gaggggctgg gactgctcga tatggagcgc ggcgcgaagg tctcgggctc gcggttctac       480
     ttcatgaccg gtcacggcgc gctgttccag atggcgctgc tgcaactcgc cgtgcagaag       540
     gccgtggcgc acggcttcac gctgatgatc ccgccggtac tggtgaagcc ggagatcatg       600
     ggcggcaccg gcttcctggg tgcgcacgcc gacgagatct accggctcga ggccgacgac       660
     ctgtacctcg tgggcacctc ggaggttccg ctggcggggt accacatggg cgagatcatc       720
     gatctgaacg atggtccgat tcgttatgcg gcgcagtcga gttgcttccg ccgcgaggcg       780
     ggttcgtacg gcaaggacac ccgcggcatc atccgggtgc accagttcga caagatcgag       840
     atgttcgtct actgcaagcc cgaggatgcc gaggccgagc accagcggct gctcgatttc       900
     gagaaggaga tgctggccgc cgtcgaggtg ccctaccggg tgatcgacgt ggccgcaggc       960
     gatctcggca gctccgccgc gcgcaagttc gactgcgagg cgtgggtgcc gtcgcaggag      1020
     cgctaccgcg agctcacgtc gacctcgaac tgcaccacct tccaggcccg ccgcctcggc      1080
     gtgcggtacc gggacgagga cggtcggccg cagatcgccg ccacgctcaa cggcacgctg      1140
     gccaccacgc gctggctcgt cgcgatctgg gagaaccacc agcagcccga cggttccgtg      1200
     cgggtccccg ccgccctgca gccgttcctc ggcacggacg tcctgcgccc gtaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page