(data stored in ACNUC1104 zone)

EMBL: CP001966.PE15

CP001966.PE15        Location/Qualifiers
FT   CDS_pept        17428..18780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0015"
FT                   /product="protein of unknown function DUF21"
FT                   /note="KEGG: mgi:Mflv_2683 CBS domain-containing protein;
FT                   PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SMART:
FT                   CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76669"
FT                   /db_xref="GOA:D5UPB7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB7"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADG76669.1"
FT                   /translation="MLAVLSILAGIVVVLLITAFTGYFVAQEFAYMAVDRSRLKARAET
FT                   GDPAANRALSVTKRTSFMLSGAQLGITVTGLLVGYVAEPLIGQGLGTLLGGVGVPSAVG
FT                   IAIGAIAAVGLSTVAQMVFGELFPKNLAISRPEPVALQLSLSTTIYLKVFGWLIRFFDA
FT                   ASNVLLRAVRIEPVHDVEHSATPRDLEHIVAASRDAGELPAELSTLLDRILDFPTHTAE
FT                   HAMIPRSRVDVVPAGEPAGAVLDRMADGHTRYPVVGATSDDLIGVITLHDLLTDTSGTA
FT                   ATRCRPAVVVPASLPLPAVVAQLADARQEMALVIDEYGGFDGVVTVEDIAEELVGEIDD
FT                   EHDPGAADPAVPEGEGWLVRGDLHIDELERLLDLDLEPGDYETIGGAVITRLAALPRPG
FT                   DTVDLPVVPEPPNLLDDAPPQRFLRAEVRTVERRVPDRVHLTVRTEEAGDG"
     gtgctagccg tcctgagcat cctcgcgggc atcgtggtgg tgctgctcat caccgccttc        60
     accggctact tcgtagccca ggaattcgca tacatggccg tcgaccggtc gcgcctgaag       120
     gcgcgggccg aaaccggcga tcccgcagcg aaccgcgctc tgtccgtcac caagcggacc       180
     tcgttcatgc tctccggggc ccagctcggc atcaccgtca ccggcctcct ggtcggctac       240
     gtggccgaac ccctcatcgg tcaaggcctg ggcacactgc tcggcggtgt gggcgtgccg       300
     tccgccgtgg gcatcgcgat cggcgcgatt gccgcggtgg gcctgtcgac cgtcgcgcaa       360
     atggtgttcg gagaactgtt cccgaagaat ctcgccatct ctcggccgga acccgttgcg       420
     ctccagctat ccctgtcgac cacgatctac ctgaaggtgt tcggctggct catccgcttc       480
     ttcgacgccg cctccaacgt actgctgcgc gcggtgcgga tcgaacccgt gcacgatgtg       540
     gagcactcgg ccaccccgcg cgacctcgaa cacatcgtgg ccgcctcccg tgatgccggt       600
     gaactcccag ccgaactgtc cacactgctc gacaggattc tcgatttccc cacgcacaca       660
     gccgaacatg ccatgatccc gcgctcgcgg gtcgacgtgg tccctgccgg tgaacccgcg       720
     ggagccgtcc tcgatcgcat ggcggacgga cacacccggt acccggtggt cggtgcgacg       780
     tccgacgacc tgatcggtgt gatcaccctg cacgacctgc tcaccgacac ttcaggcacc       840
     gcggccactc gctgccggcc ggcggtggtg gtccccgcct ccctgccgtt acccgccgtg       900
     gtggcccagc tcgccgacgc gcggcaggag atggcgctgg tgatcgacga gtacggcggt       960
     ttcgacggtg tggtgaccgt cgaggacatc gccgaggagc tggtcggtga gatcgacgac      1020
     gaacacgatc ccggagccgc tgatccggcg gttccggagg gcgaaggctg gctggtgcgc      1080
     ggagacctgc acattgatga gctcgaacgc cttctcgacc tcgacctcga acccggagat      1140
     tacgagacga tcggcggcgc ggtgatcacc cgcctcgccg ccctcccgcg accgggcgac      1200
     accgtcgacc tgccggtcgt acccgaaccg cccaacctac tcgacgacgc accgccgcaa      1260
     cgattcctgc gagcagaggt acgcaccgtc gagcggcgcg taccggaccg cgtgcacctg      1320
     accgtgcgaa ccgaggaggc cggcgatgga taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page