(data stored in ACNUC1104 zone)

EMBL: CP001966.PE151

CP001966.PE151       Location/Qualifiers
FT   CDS_pept        complement(155001..155735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76805"
FT                   /db_xref="GOA:D5UQ37"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76805.1"
FT                   /translation="MSEPEFDRERRAAARSVRESHLMVRLFIALGVLTIAAGCYFTVVD
FT                   TMFLASASTAEGRVVDYEESASPKENGRTEYSYQRIVGYTVDGVDYRKRESGASSSEPA
FT                   IGDAVTVYYDPDDPQHAMIDAFMRKWLGPLAIIFGVLWTALFAAIQRWTRRKQGERERT
FT                   AFHGARIPLTVTDLRDSEWRDDDGNTRRAVVATMTGTDSGTGEARVFTRSYEGRWRHRR
FT                   APALGAPYVAFVDDSGAIIIPA"
     atgtccgagc cggaattcga ccgggaacga cgagccgccg cccgctccgt gcgtgaatca        60
     cacctgatgg tccggctctt catcgccctc ggcgtgctca ccatcgccgc gggttgttac       120
     ttcaccgtgg tcgacaccat gttcctggcg tcagcaagca ccgccgaggg gcgcgtggtg       180
     gactacgagg agagcgcgtc ccccaaggag aacgggcgaa ccgagtacag ctaccagcgc       240
     atcgtcgggt acaccgtgga cggcgtcgac taccgcaagc gggaatcggg ggcatcgtcg       300
     agcgagccgg cgatcggtga cgcggtcacc gtgtactacg accccgacga tccgcagcac       360
     gccatgatcg atgccttcat gcggaagtgg ttgggcccct tggcgatcat cttcggcgtg       420
     ctgtggaccg cactgttcgc ggcgatccag cgttggaccc gccgcaagca gggcgagcgg       480
     gagcggaccg cgttccacgg cgcccggatc ccgctgacgg tcaccgatct ccgcgacagc       540
     gagtggcgcg acgacgacgg aaacacgcgc agggccgtgg tcgccaccat gacgggaaca       600
     gactcgggca ccggcgaggc ccgggtattc acgcgcagtt acgagggccg gtggcggcac       660
     cgccgggcgc cggcgctcgg cgcgccctac gtcgccttcg tggacgactc gggagcgatc       720
     atcatcccgg catga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page