(data stored in ACNUC1104 zone)

EMBL: CP001966.PE152

CP001966.PE152       Location/Qualifiers
FT   CDS_pept        complement(155735..156154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76806"
FT                   /db_xref="GOA:D5UQ38"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76806.1"
FT                   /translation="MWIVRVGIALARPIGPQWDWRFLVIPTISALGLTAAVFNLPREAR
FT                   WTYAKPRLEATSAAIRSGAMPVRSGESLRIGSYSLSYDDRADGNIWFRVVDAGFLNSEY
FT                   LVHSPVGHAVRPAEERHRNTVEHFDGQWWLVNEVF"
     gtgtggatcg tccgggtcgg tatcgcgctc gcccggccga tcgggccaca gtgggactgg        60
     cggttcctcg tgatcccgac gatcagtgcc ctcgggctca ctgccgccgt gttcaatctg       120
     ccccgggagg cccgctggac gtacgccaaa ccgcgcctgg aggccacgtc ggcggcgatc       180
     cgctccgggg caatgccggt gcggagcggg gagtcgctgc ggatcggtag ctactccctc       240
     agctacgacg accgcgccga cggcaacatc tggttccgcg tcgtcgacgc cgggttcctc       300
     aactccgagt acctcgtcca ctcccctgtg gggcacgccg tgcggcccgc cgaggagcgc       360
     catcgcaaca ccgtggaaca cttcgacggg cagtggtggc tggtcaacga ggtcttctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page