(data stored in ACNUC1104 zone)

EMBL: CP001966.PE154

CP001966.PE154       Location/Qualifiers
FT   CDS_pept        complement(156355..156942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_00790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76808"
FT                   /db_xref="GOA:D5UQ40"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76808.1"
FT                   /translation="MTTSASTALTPRAWWHRPPGLPLALASLIACGTWMVEASTPQDGS
FT                   PTLGVAILAGLSLIAFTWIGRTMISLAHRPRWSVRYAAVPLIGLITLGLVYLDVPFAAR
FT                   WIQAKPAFEHAAHAALADAQPTPTQLRLGTFSVTRSTVEGTVRFRLGTGAIGDTHYIVF
FT                   SPAGRPHTYGPPSEHDRVAHFDGPWWRVIDMY"
     atgaccacct ctgcatccac tgcgctcacg ccccgggcgt ggtggcaccg gccgccgggg        60
     ttgcctctgg ccttggcgag cctgatcgcg tgcggtacgt ggatggtgga ggcgagtacg       120
     ccgcaggacg ggagtccgac gctcggggtg gcgatcctcg ccggactgag cctgatcgca       180
     ttcacctgga tcggacggac gatgatctca ctcgcacacc ggccccgctg gagcgtgcgg       240
     tacgcggcgg taccgctgat cggtctgatc accctcggcc tggtgtacct cgacgtcccc       300
     ttcgctgcgc gctggatcca ggcgaagccc gcgttcgagc acgccgccca cgctgcgctc       360
     gctgatgcgc agcccacccc cacgcaattg cgactgggca ctttctccgt cacccggtcc       420
     acggtcgagg gcaccgtccg atttcggttg ggcacgggcg cgatcggcga tacccactac       480
     atcgtgttct cccccgctgg gaggccgcac acctacggcc cgccctccga gcacgatcgg       540
     gtggctcact tcgatggtcc gtggtggcgg gtcatcgaca tgtactga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page