(data stored in ACNUC1104 zone)

EMBL: CP001966.PE157

CP001966.PE157       Location/Qualifiers
FT   CDS_pept        159698..160468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0157"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: mab:MAB_0165 putative acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76811"
FT                   /db_xref="GOA:D5UQ43"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ43"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG76811.1"
FT                   /translation="MEPIYGTIIKVARGMWAYQGIQFTEVDFQKFPREGGAVVAINHTG
FT                   YLDFPFAGKPADEAGHRKVRFMAKKEVFDNSKTGPLMRGCKHIPVDREAGAEAYAAAVD
FT                   ALKAGELVGVYPEATHSRSFELKGFKSGAARMAIEANVPIVPVVVWGAQQIWTKGLPKQ
FT                   LGRNKFRVLIGVCDPLDPVGPPDELTARLKGEMQTMLYQLQDLYGPHPQGAAWVPRRLG
FT                   GSAPTLEEADALDAADIEERRRRREERLGSGDDA"
     gtggaaccca tctacggaac gatcatcaag gtagcccgcg gcatgtgggc ctaccagggc        60
     atccagttca ccgaggtgga cttccagaag tttccgcgcg agggcggtgc ggtggtggcc       120
     atcaaccaca ccgggtacct cgattttccg ttcgccggga agccggccga cgaggcgggg       180
     catcgcaagg tgcgattcat ggcgaagaag gaggtcttcg acaattcgaa gaccggcccg       240
     ctgatgcgcg gctgcaagca catccccgtc gatagggaag caggtgccga ggcctatgcc       300
     gccgccgtgg acgcgctcaa ggcgggcgag ctggtggggg tgtaccccga ggccacgcac       360
     agtcgcagct tcgagctgaa gggcttcaaa tccggtgccg cgcgcatggc gatcgaggcc       420
     aacgtcccga tcgttcccgt cgtggtgtgg ggcgcgcagc agatctggac caagggtctc       480
     ccgaagcagt tgggccggaa caagttccga gtgctgatcg gcgtctgtga tccgctcgat       540
     cccgtcggtc cgcccgacga gctcaccgcc cggctcaagg gtgagatgca gacgatgctc       600
     taccaactgc aagacctgta tggcccgcat ccgcagggcg cagcctgggt gccgcgccgc       660
     ctgggcggta gcgcgcccac cttggaggag gccgacgcgc tggacgcggc cgatatcgag       720
     gagcggcgcc gccgccggga ggagcggctc ggctcgggtg acgatgcctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page