(data stored in ACNUC1104 zone)

EMBL: CP001966.PE164

CP001966.PE164       Location/Qualifiers
FT   CDS_pept        168493..169413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0164"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: rer:RER_02140
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76818"
FT                   /db_xref="GOA:D5UQ50"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ50"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ADG76818.1"
FT                   /translation="MSEEPIEHGEPKVPSNLATGLIKAMRPRQWVKNVLVVVAPLAAGR
FT                   DQLEFVNFPNVGLAFIAFCLAASSIYLINDALDVEADRAHPTKRYRPIAAGVVPVNVAY
FT                   AVAFLLAAGAIGVSLLANKELAIVIGAYLVIQLGYCLGLKHQPVIDICIVSSGFLLRAV
FT                   AGGVAAELPKGLSQWFLLVMAFGSLFMAAGKRYAELQLAERTGAKIRKSLEYYTTTYLR
FT                   FVWTLAATSVVLCYGLWAFDKTTHPDNIWYTLSMVPFTVAILRYAVDVDGGEAGEPEEI
FT                   ALGDRVLQVLAVMWIGTVVAAVYFA"
     atgagcgagg agccgatcga gcacggcgag ccgaaggtgc cgtcgaacct cgccaccgga        60
     ttgatcaagg cgatgcgacc ccggcagtgg gtcaagaacg tcctggtcgt ggtcgcaccg       120
     ctcgccgcgg gccgcgatca gctcgagttc gtcaacttcc cgaacgtcgg gctggccttc       180
     atcgccttct gcctggccgc ctcgtcgatc tacctgatca acgacgccct ggacgtcgag       240
     gctgatcgcg cgcacccgac caagcggtac cgtcccatcg ccgccggtgt ggtcccggtc       300
     aacgtcgcct acgccgtcgc attcctgctg gccgctgggg cgatcggtgt ttcgctcctg       360
     gccaacaagg agctggcgat cgtcatcggt gcctacctgg tgatccagct cggctactgc       420
     ctgggcctca agcaccagcc cgtgatcgac atctgcatcg tcagttccgg tttcctcctg       480
     cgtgccgtcg ccggtggggt cgccgccgag ctgcccaagg gcctctcgca gtggttcctg       540
     ttggtgatgg ccttcggttc gctgttcatg gcggccggca agcggtacgc cgaactgcag       600
     ctcgccgagc gcaccggtgc caagatccgc aagtcgctgg agtactacac caccacctac       660
     ctgcggttcg tgtggacact cgcggccacc tcggtggtcc tctgctacgg cctgtgggca       720
     ttcgacaaga ccacgcaccc ggacaacatc tggtacaccc tctcgatggt gccgttcacc       780
     gtcgccatcc tgcggtacgc cgtcgatgtc gacggtggcg aggccggcga gcccgaggag       840
     atcgccctgg gcgaccgcgt gctgcaggtc ctcgcagtca tgtggatagg aacggtcgtt       900
     gccgcggtct acttcgcctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page