(data stored in ACNUC1104 zone)

EMBL: CP001966.PE166

CP001966.PE166       Location/Qualifiers
FT   CDS_pept        171494..172405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0166"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fal:FRAAL1683 putative zinc-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76820"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ52"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG76820.1"
FT                   /translation="MTFAGRSIGFRNYGGPDVLVPLHDEKALDGPGRVLVRTAFSGVNP
FT                   VDVSFRIGRMDAFVGDIAAGFVPGMECCGEVVASSAPGLPVGRVVNALVLPGPAPRTGA
FT                   YAEFVQVDADRVGTVPAGLSPRAAACIPLNAVTASSILRSLDPAVETVVITGAAGALGR
FT                   FLVYASGAAGYRTIALARPGDEALLRGLGADDPVGDELRTPDVIIDAANLGAALSDRFT
FT                   SAGTVVRVRADTEYSLPHASLITATVREATDVAAHLDWWNGRIGGHPEVVGVVETFAPE
FT                   AAGAAQERLSVPGRRGRSALRW"
     gtgacattcg ctgggcgcag cataggtttt cgcaactacg gcggtccgga tgtcttggtc        60
     ccactgcacg atgagaaggc actcgacggt ccggggcgcg tgctcgtgcg caccgccttc       120
     tccggggtca atccggtgga cgtcagtttt cgcatcggtc gcatggacgc cttcgtcggc       180
     gatatcgcgg ccgggttcgt tccgggcatg gagtgctgcg gtgaggtggt cgccagctct       240
     gcgcccggtc tgcccgtcgg ccgcgtcgtc aacgccctgg tcctgccggg gcccgcaccg       300
     cgtacgggcg cgtacgccga gttcgtccag gttgacgcgg accgcgtcgg caccgtcccg       360
     gcgggtttgt ccccgcgggc cgcggcctgt atcccgctga acgcggtcac ggcatcgtcg       420
     atcctgcgct ccctggatcc ggcggtcgag acggtcgtca tcaccggtgc cgcgggcgcg       480
     ctgggccggt tcctggtcta tgccagcggt gcggcgggct accggacgat cgccctggcc       540
     cgcccgggcg acgaggcgct gcttcgcggt ctgggtgccg atgatccggt cggcgacgag       600
     ctgcgcacgc ctgatgtgat catcgatgcg gccaatctcg gtgctgcact gtcggaccgg       660
     ttcacttcgg cgggcaccgt ggtccgcgtc cgcgcggata ccgagtactc gcttccgcac       720
     gcatcgctga tcaccgccac tgtgcgggag gcgacggatg tggctgcgca cctcgactgg       780
     tggaacggcc ggatcggcgg acatccggag gtggtgggcg tggtcgagac cttcgccccg       840
     gaggcggccg gtgccgcgca ggagcggctg tcagtgcccg gccgccgcgg caggagcgct       900
     ctgcgctggt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page