(data stored in ACNUC1104 zone)

EMBL: CP001966.PE169

CP001966.PE169       Location/Qualifiers
FT   CDS_pept        175339..175806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76823"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76823.1"
FT                   /translation="MAGLRGALAVAVMTGGVLLGAVACGGSSTVSAPTTAVDGGGPTSL
FT                   PATAPESSASVPSGYPGPPSVASSPKDKEFVAKMRSEGLVASDETIIGAAQYTCDALSQ
FT                   SPNPRYVETLVKGMLGPSRTGDGVSADKADKLATDDANKLIAEAKSSYCKK"
     atggcaggac tgcgcggagc actcgcagtg gcagtgatga cgggcggcgt gctcctcggc        60
     gcggtcgcgt gcggcggcag ctcgacggtg tccgccccca ccacggcggt cgacggcggc       120
     ggccccacgt cgctgcccgc caccgccccg gagtcgtccg cgagcgtccc gtcgggctac       180
     cccggcccgc cgtcggtggc cagctcgccc aaggacaagg agttcgtcgc gaagatgcgc       240
     tccgagggcc tcgtcgcttc cgatgagacc atcatcggcg cagcacagta cacgtgcgac       300
     gcgctctcgc agagccccaa tccgcgctat gtcgagaccc tggtcaaggg gatgctcggc       360
     ccgtcgcgca ccggtgatgg cgtctcggcc gataaggccg acaagctcgc caccgatgat       420
     gcgaacaagc tgatcgcgga ggcgaagtcc tcctactgca agaagtag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page