(data stored in ACNUC1104 zone)

EMBL: CP001966.PE173

CP001966.PE173       Location/Qualifiers
FT   CDS_pept        179298..180278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0173"
FT                   /product="putative F420-dependent oxidoreductase"
FT                   /note="KEGG: rop:ROP_39410 putative oxidoreductase;
FT                   TIGRFAM: probable F420-dependent oxidoreductase; PFAM:
FT                   Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76827"
FT                   /db_xref="GOA:D5UQJ4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ4"
FT                   /inference="protein motif:TFAM:TIGR03621"
FT                   /protein_id="ADG76827.1"
FT                   /translation="MTTEPRKFRFAAGGAGNADEGGARKFVKLAQEAEELGFDTFAIPD
FT                   RLDAQVGPLAALGALAVSTSTIRLATSMLAMPFRHPAVLAKELTTIDVLSKGRLEIGLG
FT                   LGAFKDDFDQAGIEFESPDRRLQRLDEGLTVLDTLLRGQEAEFEGEIFSVQALKGYPRP
FT                   RQGPRPPIAIGAGARRTLELAARRADVVSINPRSSAEGMLKISDMSMDAVKNKVEVVKA
FT                   AAGERFADIELSWSIATIVVTDDREQVADFALKAIERGLSASIEIDKEVTIDDVLNSPY
FT                   LAIGTFDEIADQVRATRAATGMSYVGVVPTQMEAFAPVLEQLKGE"
     gtgaccactg aaccccgcaa gttccgtttc gcagcgggtg gtgcaggcaa cgccgacgag        60
     ggtggggcgc ggaagttcgt caaactcgcc caggaggccg aggagctggg cttcgacacc       120
     ttcgccatcc cggaccggct ggacgcccag gtgggcccgc tcgccgcgct cggcgccctg       180
     gccgtgagca cctccaccat ccggctggcc acctccatgc tggcgatgcc cttccggcac       240
     cccgcggtgc tggccaagga actcaccacc atcgacgtgc tgtccaaggg ccgtctcgag       300
     atcggtctgg gcctcggagc cttcaaggac gatttcgacc aggccggcat cgagttcgag       360
     agccccgacc gccggttgca gcgcctcgac gaaggcctga cggtgctcga caccctgctg       420
     cgcggtcagg aggcggagtt cgagggcgaa atcttctcgg tgcaggcgct caagggctat       480
     ccccggcccc ggcagggccc gaggccaccg atcgccatcg gcgccggggc ccggcgcacg       540
     ctggagctcg ctgcgcgccg cgcggacgtg gtctcgatca acccgcgcag ctcggccgag       600
     ggcatgctca agatctcgga catgtcgatg gatgccgtga agaacaaggt ggaggtcgtg       660
     aaggccgctg cgggcgagcg cttcgccgat atcgagctgt cctggtcgat cgccaccatc       720
     gtggtcaccg acgatcgcga gcaggtcgcg gacttcgcgc tcaaagcgat cgagcgaggc       780
     ctctccgcga gcatcgagat cgacaaggag gtcaccatcg atgacgtgct gaactcgccg       840
     tacctggcga tcggcacgtt cgacgagatc gccgatcagg tgcgcgcgac ccgcgccgcg       900
     accggtatgt cgtacgtggg tgtcgtgccc acccagatgg aggccttcgc acccgtcctc       960
     gagcagctca agggcgagtg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page