(data stored in ACNUC1104 zone)

EMBL: CP001966.PE176

CP001966.PE176       Location/Qualifiers
FT   CDS_pept        187610..189193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0176"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: rha:RHA1_ro04066
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76830"
FT                   /db_xref="GOA:D5UQJ7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ7"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADG76830.1"
FT                   /translation="MADVTDVTEQVDTPDLHTTAGKLADLHRRLEAASDPGSERAKARR
FT                   DAKGLPSARQRMHMLFDEGTFVELDQLAKSPGDDKIKDGVVIGYGLVNGRKVAAFSHDQ
FT                   TVGAGTVGEMFGRKMVKLYDFAATAGLPVVGINDSGGARIQDAATSIAWYAELGRHQDG
FT                   LCGQVPQISMILGTCVGGAVYAPANTDVLVGVEDNTYMFVTGPEVIRPTTGEMTSAEDL
FT                   GGAVKQATWGNLHHVAKDEQAAFDWVKRYLGFMPDSVHQRPPLVNPGIEPELTDTDLSL
FT                   ESIIPDADNAGYDIHDVILRVFDDGDFLEYAELWAPNIVCGFARSDGQSVGVVANQPMH
FT                   MAGTLDTQASEKAARFVRLCNSFNIPLVFLVDVPGILPGVEEEKIGTIRRSGKFIFSYV
FT                   EAAVPKVTIILRKSYGGAWAVMGSKQLGADFVFAWPTARLAVMGAEGAAAIIKRREIEE
FT                   AGENGPAIRQAFIDFYNQFMATPWLAAERGYIDGVIEPRGTRLLIRKCLRQLQDKELQR
FT                   VPRRTYLMPM"
     gtggcagacg tgactgacgt aacggagcag gtcgataccc ctgacctgca caccaccgcc        60
     ggcaagctgg ctgacctgca ccgccgcctg gaggccgcct cggacccggg cagtgaacgg       120
     gccaaggccc gccgcgacgc caagggcctg cccagcgccc ggcagcgcat gcacatgctg       180
     ttcgacgagg gcaccttcgt cgagctcgat cagctcgcga agtcgcccgg cgacgacaag       240
     atcaaggacg gcgtggtcat cggctacggc ctggtgaacg gccggaaggt cgcggccttc       300
     agccacgacc agaccgtggg cgcgggcacc gtcggcgaga tgttcggccg gaagatggtc       360
     aagctctacg acttcgccgc gaccgcgggc ctgcccgtgg tgggtatcaa cgattcgggc       420
     ggcgcccgca tccaggacgc cgccacgtcg atcgcctggt acgccgagct cggccggcac       480
     caggacggcc tgtgcggcca ggtaccgcag atctcgatga tcctcggtac ctgcgtgggc       540
     ggcgccgtgt acgcgcccgc caacaccgat gtgctggtgg gcgtcgagga caacacgtac       600
     atgttcgtca ccggccccga ggtgatccgc ccgaccaccg gcgagatgac ctccgccgag       660
     gatctgggcg gcgccgtcaa acaggccacc tggggcaacc tgcaccacgt ggccaaggac       720
     gagcaggccg ccttcgactg ggtcaagcgc tatctcggtt tcatgccgga ttcggtgcat       780
     cagcgcccgc cgctggtcaa cccgggcatc gagcccgagc tgacggacac cgatctgtcg       840
     ctggagtcga tcatcccgga tgccgacaac gccgggtacg acatccacga cgtgatcctg       900
     agggtcttcg acgacggtga cttcctggag tacgccgagc tgtgggcgcc gaacatcgtg       960
     tgcggtttcg cccgctcgga cggccaatcg gtgggtgtgg tcgcgaacca gcccatgcac      1020
     atggccggca ccctggatac tcaggcgtcg gagaaggccg cgcgcttcgt gcggctgtgc      1080
     aactccttca acatcccgct ggtgttcctg gtcgacgtgc cgggcatcct gccgggcgtc      1140
     gaagaggaga agatcggcac catccgccgg tcgggcaagt tcatcttcag ctacgtcgag      1200
     gcggccgttc cgaaggtcac catcatcctg cgcaagtcct acggtggcgc gtgggccgtg      1260
     atgggcagca agcagttggg cgccgacttc gtcttcgcgt ggccgacggc ccgtctggcc      1320
     gtgatgggtg ccgagggcgc cgccgcgatc atcaagcggc gcgagattga ggaggccggc      1380
     gagaacggcc ccgcgatccg gcaggccttc atcgacttct acaaccagtt catggccacg      1440
     ccgtggctgg cggccgagcg cggttacatc gacggtgtga tcgagcccag gggcacccgc      1500
     ctgctgatcc gcaagtgcct gcgccaactg caggacaaag aactgcagcg cgtgccgcgg      1560
     cgcacctacc tcatgcccat gtga                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page