(data stored in ACNUC1104 zone)

EMBL: CP001966.PE178

CP001966.PE178       Location/Qualifiers
FT   CDS_pept        complement(190740..191225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0178"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: xfn:XfasM23_0503
FT                   putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76832"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ9"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADG76832.1"
FT                   /translation="MSFSVPELSGSPAERYAELAGFASALIDGEPDRVANAANLSALVK
FT                   ATVPDLNWVGFYFFDGTELVVGPFQGLPACIRIPLDRGVCGAAARTGRTQRVDDVHAVA
FT                   DHIACDGATNSELVVPLVRDGELIGVFDLDSEKPARFTDDDQRGLEAIAAVYLDSLR"
     gtgtcgttct ccgtacccga gctgtccgga tcccctgccg agcgctacgc cgagctcgcc        60
     ggcttcgcca gcgccctcat cgacggcgaa cccgatcgcg tcgcgaacgc cgcgaacctg       120
     tcggcactgg ttaaggcgac ggtgcccgat ctcaactggg tgggcttcta cttcttcgac       180
     gggaccgagc tcgtcgtcgg cccgttccaa ggcctcccgg cgtgcatccg gatccccctc       240
     gatcgtggtg tgtgcggcgc agcggcacgg accgggcgca cccagcgggt cgacgatgtg       300
     cacgccgtcg ccgatcacat cgcctgcgac ggcgcgacca actccgaact ggtcgtaccg       360
     ctggtgcgcg atggcgagct gatcggcgtc ttcgacctcg acagcgagaa gcccgcccgc       420
     ttcaccgacg atgatcagcg cggcctcgaa gccatcgccg cggtctacct ggactcgctg       480
     cggtag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page