(data stored in ACNUC1104 zone)

EMBL: CP001966.PE179

CP001966.PE179       Location/Qualifiers
FT   CDS_pept        191588..192571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0179"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: rop:ROP_50250
FT                   mycolyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76833"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK0"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADG76833.1"
FT                   /translation="MRMRNGWAKRATAAAITVAAIPALAGGIGSIGAANAWGPGNAKNP
FT                   PKGFKQAFVNGAGMPNVKVRSWASTTTDPKKAPTVVLLDGLRATWDVSGWERDSNVAFL
FT                   SQKGINVVTPVGGTSSWYADWQNPSSTNRQPYRYTWASFLKTSLPQYIRSLGFSDNVSL
FT                   IGLSMSGSAALINTIESNGYYKRAASLSGLVNISAPGIPIAVGIASLDSGGYNAGLDMW
FT                   GGPLDSRWAKNDPTVQVGRFKNIPLWISAGNGVFGKYTPNPGPADVIQGVPLEWLALSQ
FT                   ARSFEGATKRAGLTKTHFDFPPAGTHTWGYWQDQVWQMQRTGWFTK"
     atgcgtatgc gcaacggctg ggccaagcgg gccactgccg ccgcgatcac cgtggctgcc        60
     attccggccc tcgcgggcgg catcggttcc atcggcgccg cgaacgcctg gggtccgggc       120
     aacgccaaga acccgccgaa gggcttcaag caggccttcg tcaacggcgc gggcatgccc       180
     aacgtgaagg tccgctcctg ggcgtcgacc accaccgacc ccaagaaggc ccccaccgtc       240
     gttctgctcg acggtctgcg cgccacctgg gacgtctccg gctgggagcg cgactccaac       300
     gtcgccttcc tgtcgcagaa gggcatcaac gtcgtcaccc ccgtcggtgg cacctcgagc       360
     tggtacgccg actggcagaa cccgtcgtcg acgaaccgtc agccctaccg ctacacctgg       420
     gcgtcgttcc tcaagaccag ccttccccag tacatccgca gcctcggctt cagcgacaac       480
     gtctcgctga tcggcctgtc gatgtcgggt agcgcggccc tgatcaacac gatcgagtcg       540
     aacggctact acaagcgcgc cgcctcgctc tcgggcctgg tgaacatctc cgcgcccggt       600
     atcccgatcg cggtcggcat cgcctcgctc gattcgggcg gctacaacgc cgggctcgac       660
     atgtggggcg gcccgctgga ctcgcgttgg gccaagaacg acccgaccgt ccaggtcggc       720
     cggttcaaga acatcccgct gtggatctcc gcgggcaacg gtgtcttcgg caagtacacg       780
     ccgaacccgg gtccggccga tgtgatccag ggtgtgccgc tggagtggct ggcgctgtcg       840
     caggcccgct ccttcgaggg cgccaccaag cgtgccggcc tcaccaagac ccatttcgat       900
     ttcccgccgg ccggcaccca cacctggggc tactggcagg accaggtgtg gcagatgcag       960
     cgcaccggct ggttcaccaa gtaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page