(data stored in ACNUC1104 zone)

EMBL: CP001966.PE182

CP001966.PE182       Location/Qualifiers
FT   CDS_pept        complement(194953..195345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0182"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mjl:Mjls_0601
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76836"
FT                   /db_xref="GOA:D5UQK3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG76836.1"
FT                   /translation="MIDHFGINCADLDAAKRFYDGVLATVGARRLMDFDVAVGYGTEQP
FT                   VFWISGAAAGTSNREAHIAFAAPDAATVDEFHRIALELGAQSLHAPRLWPEYHPGYYGA
FT                   FVRDADGNNVEAGLPRRRVSARETAA"
     atgatcgacc atttcggcat caactgcgct gacctcgacg ccgcgaagcg gttctacgac        60
     ggcgtgctcg cgacagtggg cgcacgccgg ctcatggact tcgacgtggc cgtggggtac       120
     ggcaccgagc aaccggtgtt ctggatctcg ggcgccgcgg cgggcacgtc gaatcgggag       180
     gcgcacatcg ccttcgccgc accggatgcc gccaccgtgg acgaattcca ccggatcgcg       240
     ctggagctgg gggcgcagtc actgcacgcg ccgcggctgt ggcccgagta ccaccccggg       300
     tactacggcg ccttcgtccg agatgccgac ggcaacaatg tcgaggcggg tcttccacgg       360
     cgccgggtga gcgcccgcga gactgctgcg tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page