(data stored in ACNUC1104 zone)

EMBL: CP001966.PE183

CP001966.PE183       Location/Qualifiers
FT   CDS_pept        complement(195428..197104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0183"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: mgi:Mflv_0749 phosphoenolpyruvate-protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76837"
FT                   /db_xref="GOA:D5UQK4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK4"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADG76837.1"
FT                   /translation="MSSQQSTVTVLAGTAVVPGVAYAPVMWPGERPELPAVGGELPETE
FT                   RDAEAVRLSSAARTVAGRLRERASQATGAASEVLAATAGLASDKAWLSAAEKLIRSGSP
FT                   AEGAVAAATEQFADMFTTIGGLMAERVTDLRDVRDRVLAELLGRPEPGVPTPTAPSVLL
FT                   ADDLAPADTAGLDPALVVGIGTRLGGPTSHTAIIARQLGIPCIVGLAEAGTVEAGTLVL
FT                   LDGAEGTVTVAPPADGARARVAEAMRMAEDVARWRGPGRTSDGTAVAILANVQDGPSAR
FT                   TAAERQVEGVGLFRTELAFLNRADEPSVDEQQALYREVIDAFPAGKVVIRTLDAGSDKP
FT                   LKFIDHGHEDNPALGIRGIRIAATDPGLLERQLDAIAAAATGAAEAPWVMAPMIATAAE
FT                   ARSFAAQCRARGLTPGVMIEVPAAALCAEAVLAEVDFVSVGTNDLTQYAMAADRMSSEL
FT                   AALTDPWQPAVLRLIRLTADAGAGAGKPVGVCGEAAADPLLACVLVGLGVTSLSCAAGA
FT                   AAAVGARLGGVTLQQCRWAAEAAVASADPQAARDAARRALS"
     atgagttcgc agcagtcgac cgtcaccgtc ctcgcgggca ccgccgtggt gcccggcgtg        60
     gcctatgccc ccgtgatgtg gcccggagaa cggccggagc tccccgccgt cggcggcgag       120
     ctccccgaga ccgagcgcga tgcggaagcc gtgcgcctct cctccgcggc gcgcacggtg       180
     gcggggcgac tgcgcgagcg cgcctcccag gccaccggag ccgcgtccga ggtcctcgcc       240
     gcgaccgccg ggctcgcctc cgacaaggcg tggctgagtg ccgcggaaaa gctcatccgc       300
     tccggctcgc cggcggaggg cgccgtggcg gcggcgaccg aacagttcgc ggatatgttc       360
     accacgatcg gcggcctgat ggctgagcgc gtgacggacc tgcgcgacgt ccgcgaccgg       420
     gtgctcgccg aactcctggg ccgccccgaa cccggcgtgc cgacgccgac ggcaccgtct       480
     gttctgctcg ccgacgacct ggcgcccgcc gacactgcgg ggctggaccc cgcgctggtc       540
     gtgggcatcg gcacccggct cggcggaccc accagccaca ccgcgatcat cgcccggcag       600
     ttggggattc cctgcatcgt cggactggcc gaggcgggca ccgtcgaggc cgggaccctg       660
     gtactactgg atggcgccga gggcaccgtc accgtcgccc cgccggccga cggggcgagg       720
     gcccgggtcg cggaggccat gcggatggcc gaggacgtcg cgcggtggcg cggccccggt       780
     cgcacgtccg acgggaccgc tgtcgcgatc ctggcgaacg ttcaggacgg acccagcgcg       840
     cgaaccgccg ccgagcgtca ggtggagggt gtcggtctgt tccgcaccga gctcgccttc       900
     ctgaaccggg ccgacgagcc ttcggtcgat gagcagcaag cgctgtaccg cgaggtgatc       960
     gacgcctttc ccgccggcaa ggtggtgatc cggaccctcg atgccggatc cgataagccc      1020
     ctgaagttca tcgaccacgg gcacgaggac aaccccgcgc tcggtatccg cgggatccgc      1080
     atcgccgcaa ccgatcccgg cctcctggaa cgccagctcg atgcgatcgc ggcggccgcc      1140
     accggggccg cagaggcgcc gtgggtgatg gcgcccatga tcgcgaccgc cgccgaggcg      1200
     cgatccttcg cggcacagtg ccgtgctcgc ggcctcacgc cgggcgtgat gatcgaggtg      1260
     cccgccgccg ccctgtgcgc cgaagccgtg ctcgccgagg tggacttcgt ctcggtgggc      1320
     accaacgacc tcacccagta cgcgatggcc gccgatcgga tgagctccga actcgccgcg      1380
     ctcaccgatc cctggcagcc cgccgtgctc cggttgatcc ggctgacggc cgacgccggt      1440
     gcgggcgccg gaaagcccgt cggagtgtgc ggcgaggccg ccgccgatcc gctactcgcc      1500
     tgcgtcctgg tcgggctcgg tgtgacctcg ctgtcctgcg ccgccggcgc ggccgccgcg      1560
     gtgggagccc ggctcggcgg agtgaccctg caacagtgca ggtgggccgc cgaggccgcc      1620
     gtcgcctccg ccgatccgca ggcggcgcgg gacgcggccc gccgcgcgct gagctga         1677
//

If you have problems or comments...

PBIL Back to PBIL home page