(data stored in ACNUC1104 zone)

EMBL: CP001966.PE184

CP001966.PE184       Location/Qualifiers
FT   CDS_pept        197207..197977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0184"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: mjl:Mjls_0072 DeoR family transcriptional
FT                   regulator; PFAM: regulatory protein DeoR; Helix-turn-helix
FT                   type 11 domain protein; SMART: regulatory protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76838"
FT                   /db_xref="GOA:D5UQK5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK5"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADG76838.1"
FT                   /translation="MYAEERQRAISDLVAARGRASVTELAERYDVTPETVRRDLDALER
FT                   LGGVRRVHGGVVAAGVLAGAESGVGEREVLSAEAKRAIGEAARAFLPPAGGSVLFDAGT
FT                   TTIAAAREIPAGHRLAAVTNSLAVATTLAGRDGVELRMLGGRIRGLTQAAVGAGTVAEI
FT                   AGLHADVAFLGTNGLSARRGLSTPDAEEAAVKSALLNAADVVVLLADASKFDHESLVSV
FT                   GALDRIDALVTDVAPVGELGAALAEHDVTVVVAP"
     atgtacgcgg aggaacggca gcgcgcgatc agtgatctgg tcgcagcccg cgggcgtgcc        60
     tcggtcaccg aactggccga gcgctacgac gtcacaccgg agacggtgcg ccgcgacctc       120
     gacgcattgg agcggctcgg tggagtgcgc cgggtgcacg gcggtgtggt cgccgcgggt       180
     gtactcgccg gggccgaatc cggcgtgggg gaacgcgagg tgctcagtgc cgaggccaag       240
     cgcgccatcg gcgaggcggc ccgcgccttc ctgccgccag ctggcgggtc ggtgctgttc       300
     gacgcaggca ccaccaccat cgccgccgcc cgcgagatcc ccgccggtca ccggctcgcc       360
     gcggtcacca attcgctcgc cgtcgcgacg acgctcgcgg gacgcgacgg ggtcgagctg       420
     cgcatgctcg gcggccggat ccgcggcctc actcaggctg ccgtcggcgc cggcaccgtc       480
     gccgagatcg ccggcctgca cgccgatgtc gccttcctcg gcaccaacgg cctcagtgcg       540
     cggcgcggcc tctcgacccc ggatgccgag gaggccgcgg tgaagtcggc cctgctcaat       600
     gccgccgatg tggtggtgct gctcgccgat gccagcaagt tcgaccacga gagcctggtc       660
     tcggtcggag ccctggaccg gatcgatgcg ctcgtgaccg acgtcgctcc cgtcggtgaa       720
     ctcggagccg cactcgccga gcacgatgtc acggtggtgg tcgccccgtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page