(data stored in ACNUC1104 zone)

EMBL: CP001966.PE185

CP001966.PE185       Location/Qualifiers
FT   CDS_pept        197974..198945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0185"
FT                   /product="1-phosphofructokinase"
FT                   /note="KEGG: mkm:Mkms_0090 ribokinase-like domain-
FT                   containing protein; TIGRFAM: 1-phosphofructokinase; PFAM:
FT                   PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76839"
FT                   /db_xref="GOA:D5UQK6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK6"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ADG76839.1"
FT                   /translation="MIVTVTANPSLDRLIALGAPLRRGAVHRAEATVADPGGKGVNVSR
FT                   AVHVAGEPTVAVLPADAGDPLLLALGRLGVPARAVPSGCEIRSNITIAEPDGTTTKLNS
FT                   PGAELGPAVARALEDAIVAAADGAAWVALCGSLPPGLPDDWYARIVERLAGGPRIAVDT
FT                   SGPALAAVADAGVDLLKPNAEELAELVGVGDQDFEHRVAAGDLEAARVAAEELHRRSGA
FT                   AVLATLGAAGALLVDGGTWFATPPPTTVRSTVGAGDSALAGYLLGHTAGEPAPARLRLA
FT                   VAYGSAAAALPGTRAPRPDQLATADVRLRPLETASPEEPETS"
     gtgatcgtca ccgtgaccgc caaccccagt ctcgatcggc tcatcgcgct cggcgcacct        60
     ctgcgacgcg gtgccgtgca ccgcgccgag gccaccgtcg cggaccctgg tggcaagggc       120
     gtcaacgtct ctcgtgcggt gcatgtcgcc ggtgagccca ctgtcgccgt gctgccggcc       180
     gatgccggcg acccgctcct gctcgcactc ggacgcctgg gcgtaccggc ccgcgccgtt       240
     ccgtcggggt gcgagatacg cagcaacatc accatcgccg aacccgacgg caccacgacc       300
     aaactcaact ccccgggcgc tgaactcggc ccggcggtgg cccgcgctct ggaggacgcg       360
     atcgtcgccg ccgccgacgg tgcagcctgg gtggcgctct gtggttcgct cccacccggg       420
     ctgcccgacg actggtacgc acggatcgtg gagcgtctgg ccggcggccc gcggatcgcc       480
     gtcgacacct cggggccggc gctcgcggcc gtcgccgatg ccggcgtgga cctactcaag       540
     cccaatgccg aggaactggc cgagctggtg ggtgtcggcg atcaggattt cgaacatcgg       600
     gtcgcggcag gcgatctcga agcagcgcga gtggccgccg aagagctgca ccgcaggtcg       660
     ggcgccgcag tcctggcgac cctcggcgcc gccggggccc tattggtgga cggcggcacc       720
     tggttcgcga ccccaccgcc gaccaccgtg cggagcaccg tgggcgccgg cgacagcgcg       780
     ctggccggct acctactcgg tcacaccgca ggcgagcccg ctcccgcacg cctgcggctg       840
     gccgtggcct acggatcggc tgccgccgca cttcccggta cccgcgcacc ccgccccgac       900
     caactcgcca ccgccgacgt gcggctgcgc ccgctcgaga ccgcctcgcc agaagaaccg       960
     gagacatcat ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page