(data stored in ACNUC1104 zone)

EMBL: CP001966.PE186

CP001966.PE186       Location/Qualifiers
FT   CDS_pept        198942..200963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0186"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="KEGG: mkm:Mkms_0089 PTS system, fructose subfamily,
FT                   IIC subunit; TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose-specific, IIB subunnit; PFAM:
FT                   phosphotransferase system PTS fructose- specific IIB
FT                   subunit; phosphotransferase system EIIC;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76840"
FT                   /db_xref="GOA:D5UQK7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK7"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ADG76840.1"
FT                   /translation="MTEPIITPELVALDIAAGTEKSEVIGYLAHRIAEAGRAHAVDALI
FT                   EAALAREGQSATGLPGGIAIPHCRTASVTAASLAFARLDPRVDFGAPDGPADLVFLIAA
FT                   RESGGSQHMKLLSALARALVRPEFVASLRTASTPEEVVALVDEVITPASPAPKPAPADP
FT                   PAAPPAKRPAVIAITACPTGIAHTYMAADALKLAAERAGVDLTVETQGSSGSSPLSAQT
FT                   IAEAGAVIFATDVGVKGRERFAGKPVVTSGVKRGINEPDAMIAEAVAAASDPRAAIVDG
FT                   DAATTAESAPAHAGLGGELKRALLTGVSYMIPFVAAGGLLMALGFLMAGYEIGSEHGSD
FT                   GVSNGAYFALHNSLWNLPDGGMLQYLGGVSFAIGQAAMTLMVPVLAGYIAYAIADRPGL
FT                   APGFVAGVLAGTVGAGFIGGVVGGLLAGVVALWLSRIPLPQWARGLQPVVIIPLLGTLI
FT                   TGGLMYMVLAGPLRWVNESMTSALNGMSGSSKIALGAVLGLMMCFDLGGPVNKAAYAFG
FT                   VAGIGLSTAGVPQWEIMAAVMAAGMVPPLALALATFVRPGLFTEPERENGKAALPLGLC
FT                   FISEGAIPFAAADPLRVIPTMMLGGAVTGGLSMALSAQLRAPHGGVFVMFATNGTWWKF
FT                   LVALAVGVIVSAAAVVTAKAVWRRDAPVESPQPAAVAA"
     atgaccgaac cgatcatcac gcccgaactg gtggcgctcg atatcgcggc cggaaccgag        60
     aagtcggagg tgatcggcta tctcgcgcac cgcatcgccg aggccggccg tgcccacgcg       120
     gtcgatgcgc tgatcgaggc ggccctggcc cgtgagggcc agtccgccac cggactgccc       180
     ggcggcatcg cgatcccgca ctgccgtacc gcgtccgtga ccgcagcgag cctggccttc       240
     gctcggctcg atccgcgggt cgacttcggt gcgcccgacg gtccggccga tctggtgttc       300
     ctcatcgcag cgagggaatc cggtggctcc cagcacatga aactgctcag cgccctggcc       360
     cgcgcgctgg tgcgccccga gttcgtggcc tccctccgca ccgcgagtac gcccgaggag       420
     gtggtcgcgc tcgtcgacga ggtgatcaca cccgcatcgc ccgcgccgaa gcccgctccc       480
     gccgatcctc ctgccgctcc tcccgccaag aggcctgcgg tgatcgcgat caccgcgtgt       540
     cccaccggga tcgcacacac ctacatggcc gccgatgccc tgaaactcgc cgccgagcgc       600
     gccggcgtcg acctgaccgt cgagacgcag ggctcctccg gatccagccc gctctcggcg       660
     cagaccatcg ccgaggccgg cgccgtcatc ttcgccacgg atgtgggcgt caagggacgc       720
     gagcggttcg cgggcaaacc cgtcgtcact tcgggtgtca agcgcggcat caacgaaccc       780
     gatgcgatga tcgcggaagc ggtggccgcc gcgtcggatc cgcgggccgc catcgtcgac       840
     ggcgatgcag ccacgaccgc ggaatcggca cccgcacacg cgggcctcgg cggagagctc       900
     aagcgcgcct tgctcaccgg cgtcagctat atgatcccgt tcgtcgctgc cggaggcctg       960
     ctgatggccc tgggcttcct catggcgggc tacgagatcg gtagcgaaca cggatccgac      1020
     ggtgtgtcca acggcgccta cttcgcgctc cacaattcgc tgtggaacct gcccgacggc      1080
     ggaatgctgc agtatctcgg cggcgtgagc ttcgcgatcg gtcaggccgc gatgacgctg      1140
     atggtcccgg tgctcgccgg ttacatcgcc tatgcgatcg ccgaccgtcc cggtctggca      1200
     ccgggattcg tcgcgggcgt gctcgccggc accgtgggcg ccggtttcat cggcggtgtg      1260
     gtcggcggcc tgctcgccgg tgtggtcgcg ctctggctca gccggatccc gttgccgcaa      1320
     tgggcccgcg gcctgcagcc ggtggtgatc atcccgctcc tcggcacact gatcacgggc      1380
     ggcctgatgt acatggtgct ggccggcccg ttgcgttggg tgaacgaatc gatgaccagc      1440
     gccctcaacg gcatgagcgg cagcagcaag atcgcgctcg gcgcggtcct cggcctgatg      1500
     atgtgcttcg acctgggcgg accggtgaac aaggccgcgt acgccttcgg cgtcgccgga      1560
     atcggtctca gcacggcggg ggtgccgcag tgggagatca tggccgcggt gatggccgcg      1620
     ggtatggtgc cgccgctcgc gttggcgctg gccaccttcg tgcgcccggg gctgttcacc      1680
     gagcccgagc gcgagaacgg caaggcggcc ttgccgctcg gcctgtgttt catctccgag      1740
     ggcgccatcc cgttcgccgc ggccgacccg ctccgagtga tcccgaccat gatgctcggt      1800
     ggtgccgtga ccggtgggct gtcgatggcc ctcagcgcgc agctgcgcgc cccgcacggc      1860
     ggcgtcttcg tgatgttcgc gaccaacggc acgtggtgga agttcctcgt cgcgctcgcg      1920
     gtcggcgtga tcgtcagcgc tgccgccgtc gtgaccgcca aggcggtgtg gcgtcgcgac      1980
     gctccggtcg aatcgccgca gcccgcagcc gtcgccgcgt aa                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page