(data stored in ACNUC1104 zone)

EMBL: CP001966.PE188

CP001966.PE188       Location/Qualifiers
FT   CDS_pept        complement(201303..201929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76842"
FT                   /db_xref="GOA:D5UQK9"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76842.1"
FT                   /translation="MSTQIFEHAQPRLAALRRRCDAAMGRLRGGIDEVRPTTGWRVLTS
FT                   VVYSGLIAVVIVGAAVLLLGVKPAGPAISNVSAVEVGDCVTVSDGKADRAGCDATGMTF
FT                   SVAEKVAAKTACSLGSYARVESEGATLCVVPNMTLGNCYQVRPDQSATTDIRPVTCPTG
FT                   LGGAAPANVVRVTERASGGPLNCRGTAALNYPAPQPVSYCIAPAS"
     atgtccaccc agatcttcga gcacgcgcag ccccgcctcg cggcgctccg ccggcgctgc        60
     gacgcggcga tgggccggct gcgcggcggc atcgacgagg tgcgacccac caccggctgg       120
     cgagtgctaa cctccgtcgt ctactcggga ctcatcgccg tcgtcatcgt gggcgccgcc       180
     gtgctgctgc tcggcgtcaa gccggccggc cccgcgatct cgaacgtcag cgccgtggag       240
     gtgggcgact gcgtcaccgt ctccgacggc aaggccgacc gcgcaggctg cgacgcaacc       300
     ggcatgacct tctccgtcgc cgagaaggtg gccgcgaaga ccgcgtgcag cctcggcagt       360
     tacgcccggg tcgaatccga gggcgccacc ctgtgcgtgg tgccgaacat gacactcggc       420
     aattgctacc aggtgcgccc ggatcaatcc gccactacgg acatccgccc cgtgacctgc       480
     ccgaccggac tcggcggcgc cgcacccgcg aacgtggtgc gcgtgaccga acgcgcctcc       540
     ggcggcccgc tcaactgccg cggaacggcc gcgctgaact acccggcgcc gcagccggtg       600
     agctactgca tcgcacccgc atcctga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page