(data stored in ACNUC1104 zone)

EMBL: CP001966.PE189

CP001966.PE189       Location/Qualifiers
FT   CDS_pept        202037..202954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0189"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: rer:RER_37880 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76843"
FT                   /db_xref="GOA:D5UQL0"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL0"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADG76843.1"
FT                   /translation="MPQDGPVIAVGPTPDPEFDAAITRGGGVPGPLAGAEGLVWIDSTT
FT                   VPTDIPDSVRWVQLPFAGIENFVGSGLLEHYPGITFSSAAGAYSTTVAEHALSLLLAGV
FT                   RGLWHRESEWDAKGAAPRVGLLGGSTVAIVGAGGIGRDLAPQLRALGVSVIAVNRSGSD
FT                   VTGAVVVTADKLDEVWSQVDHVVLAAPATAETRSLVDASVLAQLKPHSWVINVARGALI
FT                   DTDALVDALRRGAIGGVGLDVTDPEPLPGDHPLWSIPNAIITPHVANPPQHLRPALLDR
FT                   VEINVRRVANGLQPLAVVDRAKGY"
     atgccacagg acggacccgt catcgccgta ggccccaccc cggatccgga gttcgatgcc        60
     gccatcaccc gcggtggcgg tgtcccggga ccgctcgccg gtgccgaggg cctggtgtgg       120
     atcgattcca cgacggtccc caccgacatc ccggattcgg tgcgctgggt gcaactgccc       180
     ttcgccggga tcgagaactt cgtggggtcg ggactgctgg agcactaccc cggcatcacc       240
     ttctcctcgg ctgccggcgc ctacagcacc accgtcgccg aacacgcgct ctctctgctg       300
     ctcgcgggcg tccgtggtct gtggcaccgg gaaagcgagt gggatgcgaa gggcgccgcc       360
     ccgcgcgtcg gcctgctcgg cggctccacc gtggccatcg tcggcgccgg cggcatcggc       420
     cgcgacctgg cgccgcagtt gcgcgccctc ggtgtcagcg tgatcgccgt gaaccgttcc       480
     gggagcgatg tgaccggcgc cgtggtggtc accgctgaca agctcgacga ggtgtggtcg       540
     caggtcgacc acgtggtgtt ggcggctccc gccaccgccg agaccaggtc gctggtcgac       600
     gcctcggtgc tggcccagct caagccgcac tcctgggtga tcaacgtggc ccgtggcgcg       660
     ctgatcgaca ccgatgccct ggtcgatgcg ttgcgccggg gcgcgatcgg tggcgtgggt       720
     ctcgacgtga ccgatccgga gccgttgccc ggcgaccacc cgctctggtc gatccccaat       780
     gcgatcatca cgccgcacgt ggcgaatccg ccgcagcacc tgcggcccgc cctgctcgac       840
     cgggtggaga tcaacgtgcg ccgggtcgcc aacggcctgc agccgctcgc ggtggtcgat       900
     cgcgccaagg gctactga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page