(data stored in ACNUC1104 zone)

EMBL: CP001966.PE192

CP001966.PE192       Location/Qualifiers
FT   CDS_pept        205225..206646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0192"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: msm:MSMEG_4108 NAD(P) transhydrogenase, beta
FT                   subunit; PFAM: NAD(P) transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76846"
FT                   /db_xref="GOA:D5UQL3"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL3"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADG76846.1"
FT                   /translation="MSVESIATAAYLVAALLFILSLAGLSKHESARTGWLYGVIGMVIA
FT                   IAATVALALNKSEVAGTATVILVVTALIGAAIGLYRARVVQMTGMPELIALLHSFVGLA
FT                   AVLVGWASYLEVERGWIPGEAAHYTGGLLKIHHAEVFIGVFIGAVTFTGSIVAYLKLSA
FT                   KMKSAPLVLPGKNYINIGALVLFAVFTVWFVIDQQLWLLIAVTVIALLLGWHLVASIGG
FT                   GDMPVVVSMLNSYSGWAAAAAGFLLSNDLLIVTGALVGSSGAYLSYIMCKAMNRSFISV
FT                   IAGGFGIEAAPSEDQDYGEHTETNADSVAELLKNAKTVVITPGYGMAVAQAQYGVAELT
FT                   RELRKRGVTVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDVVLVIG
FT                   ANDTVNPAAAEDPNSPIAGMPVLTVWEAENVIVFKRSMASGYAGVQNPLFFRTNSAMLF
FT                   GDAKDRVQDILAAIN"
     atgagcgtcg aatccatcgc gaccgccgcg tatctcgtcg cagcgctgct gttcatcctg        60
     agtctcgccg gcctctccaa gcacgagagc gcccgcaccg gctggctgta cggcgtgatc       120
     ggcatggtca tcgccatcgc ggccactgtt gcgctcgcgc tcaacaagag tgaggtggcc       180
     gggaccgcca ccgtgatcct ggtggtgacc gcgctgatcg gtgccgcgat cggcctgtac       240
     cgggccaggg tcgtgcagat gaccgggatg cccgagctga tcgcgttgct gcacagcttc       300
     gtcggtctcg ccgcggtcct cgtcggctgg gcctcgtatc tcgaggtcga acgcggctgg       360
     atcccggggg aggccgcgca ctacaccggt ggcctgctca agatccacca cgccgaggtg       420
     ttcatcggtg tgttcatcgg tgcggtcacc ttcaccggtt cgatcgtcgc gtacctcaag       480
     ctctcggcga agatgaagtc ggcgccgctg gtgctgcccg gcaagaacta catcaacatc       540
     ggtgcgctgg tgctgttcgc cgtgttcacc gtgtggttcg tgatcgacca gcagctgtgg       600
     ctgctgatcg ccgtcaccgt gatcgccctg ctgctcggct ggcacctcgt cgcctccatc       660
     ggcggcggcg acatgccggt cgtggtgtcg atgctcaaca gctactcggg ctgggcggct       720
     gcggccgcag gcttcctgct cagcaacgac ctgctgatcg tgaccggcgc attggtcggc       780
     tcgtccggtg cgtacctgtc ctacatcatg tgtaaggcga tgaaccgctc gttcatctcc       840
     gtgatcgccg gtggtttcgg catcgaggcc gcgcccagcg aggatcagga ttacggcgag       900
     cacaccgaga ccaatgccga cagcgtggcc gagctgctca agaacgccaa gaccgtcgtc       960
     atcactcccg gctacggcat ggccgtggcg caggcgcagt acggtgtggc cgagctgacc      1020
     cgcgaactcc gcaaacgcgg tgtcacggtg cgattcggaa tccatcccgt tgccggtcgc      1080
     ctgccaggac atatgaacgt gctgctcgcc gaggcgaagg tcccctacga catcgtgctc      1140
     gagatggatg agatcaacga tgatttcgcc gacaccgacg tggtgctggt gatcggagcc      1200
     aacgacaccg tgaacccggc agcggccgag gatccgaaca gcccgatcgc gggcatgccg      1260
     gtgctcacgg tgtgggaggc cgagaacgtg atcgtgttca agcggtcgat ggcgtccggc      1320
     tatgccgggg tgcagaaccc gctgttcttc cgcaccaact cggcgatgct gttcggagac      1380
     gccaaggacc gcgtgcagga catcctcgcc gcgatcaact ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page