(data stored in ACNUC1104 zone)

EMBL: CP001966.PE194

CP001966.PE194       Location/Qualifiers
FT   CDS_pept        complement(207406..208017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0194"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   kra:Krad_4013 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76848"
FT                   /db_xref="GOA:D5UQL5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADG76848.1"
FT                   /translation="MTSALLAGLGLGLSLIVAIGAQNAYILQVGVRGRGIAPVVAVCIA
FT                   SDVALICAGVAGLGAAVSGRPAVLEAVKWAGTVVLIGYGLRSLWAARRADGLTAGGNTA
FT                   GSVAAVITAALALTWLNPHVYLDTVLLLGSASTRYGTDRWWFAAGAVIASIAWFGLLGF
FT                   GARRLAGTLGRPAVWRALNAGIGVLLLVLAARLATLPLGG"
     atgacctccg ccctcctcgc cggcctcggc ctcggcctct cactgatcgt ggccatcggc        60
     gcgcagaacg cctacatcct ccaggtgggc gtgcgcgggc gcgggatcgc accggtggtg       120
     gcggtgtgca tcgcctccga cgtcgcactg atctgcgcgg gcgtcgccgg cctgggcgcg       180
     gccgtctcag ggagaccggc ggtgctggag gcggtgaagt gggccggaac ggtggtgctc       240
     atcgggtacg ggctgcgatc actgtgggct gcgcgccgcg cggacgggct caccgccggc       300
     gggaacaccg cgggatcggt cgcggccgtg atcaccgccg cactcgcgct gacctggctc       360
     aaccctcacg tctatctcga tacggtgctc cttctggggt cggcatcgac gcggtacggc       420
     accgaccgct ggtggttcgc cgccggtgcg gtgatcgcca gcatcgcctg gttcggtctc       480
     ctcggattcg gtgcgcggcg cctcgccggc accctcggca ggcccgcggt gtggcgtgcg       540
     ctcaacgccg gcatcggagt gctgctcctg gttctggccg cgcgcctggc gacgctgccg       600
     ctcggcggat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page