(data stored in ACNUC1104 zone)

EMBL: CP001966.PE198

CP001966.PE198       Location/Qualifiers
FT   CDS_pept        complement(211336..212199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0198"
FT                   /product="peptidase S58 DmpA"
FT                   /note="PFAM: peptidase S58 DmpA; KEGG: fal:FRAAL5354
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76852"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL9"
FT                   /inference="protein motif:PFAM:PF03576"
FT                   /protein_id="ADG76852.1"
FT                   /translation="MPASLVVTIPGVRIGHHTDAAARTGCTVVILPDGTVGSGEVRGGA
FT                   PASREFDLLSPERSVGEIHAAVLTGGSAFGLACADGVMRRLEEEGRGVQTVAGRVPIVP
FT                   TLGLFDLMVGDSAVRPTAENGYTAAASAAHDAEVNGLIGAGTGATVGKSRGIDGIRDAG
FT                   LAYAEARSGALIVGALCAVNAFGDVLTGAAADPGLGDYAPFATPGERENTTIGVVLTNA
FT                   RLTKSECLILAQGAHDGLARAIDPPHTRFDGDAFISAATGQVDAKIDLVRALAIGAVTE
FT                   AIRSRA"
     atgcccgcca gcctcgtcgt gaccattccc ggcgtccgca tcggtcacca caccgacgcg        60
     gcggcccgca ccggctgcac cgtggtcatc ctccccgacg gcaccgtcgg ttcgggtgag       120
     gtgcgcggtg gagcgccggc ctcccgcgag ttcgacctgc tctcgccgga acgctcggtc       180
     ggggagatcc acgccgccgt gctcaccggg ggctccgcgt tcgggctcgc ctgcgccgac       240
     ggggtgatgc gccgcctgga agaggaaggc cgcggcgtac agaccgtggc cggtcgggtg       300
     ccgatcgtcc cgacactggg cctgttcgac ctcatggtgg gcgactcggc tgtgcgtccg       360
     accgccgaga atggctacac cgcagcagct tccgcagctc acgacgccga agtcaacggc       420
     ttgatcggcg ccggcaccgg ggccaccgtg ggcaagtccc gcggcatcga cgggatccgc       480
     gacgccggcc tggcctacgc cgaggcccgc tcgggcgcac tgatcgtggg cgcactgtgt       540
     gccgtgaacg ccttcggcga cgtcctgacc ggggccgccg cagacccggg cctcggggac       600
     tacgcgccgt tcgcgacgcc gggcgagcgg gagaacacca cgatcggcgt cgtgctcacc       660
     aatgcccgcc tcaccaagag tgagtgcctg atcctcgccc aaggtgccca cgacgggctg       720
     gcacgcgcga tcgatccacc gcatacccga ttcgacggtg acgccttcat ctccgccgcc       780
     accggccagg tggacgcgaa gatcgacctg gtccgcgcac tcgcgatcgg tgccgtcacc       840
     gaagccatcc gctcgcgcgc ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page