(data stored in ACNUC1104 zone)

EMBL: CP001966.PE200

CP001966.PE200       Location/Qualifiers
FT   CDS_pept        complement(212597..213076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0200"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: rer:RER_45540 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76854"
FT                   /db_xref="GOA:D5UQM1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG76854.1"
FT                   /translation="MTDSDAPTVDGDPLALERQVCFALAVANRAVLSVYRPILAPMGLT
FT                   HPQYLVMLALWGAAPMSVKEIGEALQLDSPTLSPLLKRLEAQGLITRSRAAHDERQIDV
FT                   DLTDAGRALREQALNVPPAVIERLGASLSELEDLHRVLTTINARALAAGALERET"
     atgaccgatt cggacgcccc cactgtcgac ggagatcccc tggccctcga acgccaggtg        60
     tgcttcgcgc tcgccgtcgc caaccgcgcg gtgctctcgg tgtaccggcc gatcctcgcc       120
     ccgatgggcc tcacccaccc gcagtacctg gtgatgctcg cgttgtgggg cgcagcgccg       180
     atgtcggtga aggagatcgg cgaggccttg cagttggact ctcccacgct gagcccgctg       240
     ctcaagcgcc tcgaggcgca gggattgatc acccgcagcc gcgcggcgca cgacgagcga       300
     cagatcgacg tcgacctcac cgatgccggt cgcgcgctgc gcgagcaggc gctcaacgtc       360
     ccgcccgccg tgatcgaacg gctcggcgcc agtctgtccg agctcgagga tctgcaccgc       420
     gtgctcacca ccatcaacgc ccgagccctg gccgcgggcg ccctcgagag ggagacgtag       480
//

If you have problems or comments...

PBIL Back to PBIL home page