(data stored in ACNUC1104 zone)

EMBL: CP001966.PE201

CP001966.PE201       Location/Qualifiers
FT   CDS_pept        complement(213125..215461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0201"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="KEGG: mav:MAV_1056 ATP-dependent DNA ligase;
FT                   TIGRFAM: DNA polymerase LigD, polymerase domain protein;
FT                   DNA ligase D, 3'-phosphoesterase domain protein; DNA
FT                   polymerase LigD, ligase domain protein; PFAM: ATP dependent
FT                   DNA ligase; DNA primase small subunit; ATP dependent DNA
FT                   ligase domain protein; mRNA capping enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76855"
FT                   /db_xref="GOA:D5UQM2"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033649"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM2"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ADG76855.1"
FT                   /translation="MAQTRENREVDGVHVQLTNLDKVLYPATGTTKAEVIDYYQAIAPV
FT                   AVPHLRDRPLTRKRWPNGVDKTAFFEKRLPSHAPAWIRRGAQHHSDGESLYPVVENTAD
FT                   MVWLGQQAALELHVPQWTFIADGENEEPGPPDRLVLDLDPGPGSTLDDCAALALRIRDL
FT                   LAAMGLDGHPVTSGSKGMHIYSTLPGGLSSPGARKVAHAIASQLEAESPELVTASMSKD
FT                   QRGGRIFVDWSQNSGSKTTISPYSLRGREHPWVAAPRSWDELSRPGLQQLEFHDVLARV
FT                   RTSGDLLAPLLSGTPAPPEPVDLDEYRAKRDAAKTPEPFGGAASTGDPIFVIQEHHARR
FT                   LHYDFRLEHDGVLASWAVPKNLPDDPAVNHLAVRTEDHPMDYAAFEGSIPKGEYGGGDV
FT                   SIWDHGTYELEKWRKDEVIVTLHGARLRGLRYALIRTGEKNWLAHLTKDKTAPAKAAAA
FT                   QAPDPMLPSESTIDRLSGEDWAFEGKWDGYRIMATVRGGALSLRTRSGRVVTGEFPEFE
FT                   SLARDLDGMDVVLDGEAVVLDDAGVPSFHLMAGGESRTGAVRLYLFDVLELNGVDLTKR
FT                   PWSVRREVLESLAPLLDSDDSIGVPALVEASTGLVAATLSAERGWEGIVAKRRDSPYLP
FT                   GQRVRAWLKHKNWRDLQVAIGGWKPGKGSRANRIGSVLVGLPAETGLVYLGSVGSGLRD
FT                   RDLDALAQRLEPLRMKRSPFTASIDDPDARDAVWVLPQVVGDVRYSSLRRGGHLRQPSW
FT                   RGFRDDLLPGDLPGEAEIPWEGPDE"
     gtggcgcaga ctcgggagaa ccgtgaggtg gacggcgtcc acgtgcaact gaccaacctc        60
     gacaaggtgc tctacccggc caccggtacc acgaaggccg aggtgatcga ctactaccag       120
     gcgatcgccc ccgtcgcggt cccccacctg cgcgaccggc cgctcacccg caaacgctgg       180
     cccaacggcg tcgataaaac cgccttcttc gaaaagcgcc tccccagcca tgccccggcc       240
     tggatccgcc gcggcgccca gcaccactcc gacggcgaat cgctctatcc cgtggtcgag       300
     aacacggccg atatggtgtg gctgggacag caagccgcgc tcgagctcca cgtaccgcag       360
     tggacgttca tcgccgacgg cgagaacgag gagccgggcc cgcccgatcg cctggtcctc       420
     gacctcgatc ccggccccgg cagcacgctc gacgattgcg ccgcactcgc gctgcgcatc       480
     cgcgatctgc tcgcagccat gggactggac gggcacccgg tcaccagcgg ctccaagggc       540
     atgcacatct attcgacctt gcccggcggc ctcagcagcc cgggcgcgcg gaaggtggcg       600
     cacgccatcg cgtcccaact ggaggccgag tcaccggaac tggtgaccgc ctccatgtcg       660
     aaggaccagc gcgggggccg catcttcgtg gactggtcgc agaacagcgg atccaagacc       720
     acgatctcgc cgtattcgct acgcgggcgc gagcatccgt gggtggcggc accccgcagc       780
     tgggacgaac tgtcccggcc gggcttgcag cagttggagt tccacgacgt gctggcccgc       840
     gtgcggacga gcggcgatct gctcgctcca ttgctctcgg gcacaccggc accgcccgag       900
     ccggtcgacc tcgacgaata ccgggctaag cgcgatgccg cgaagacgcc ggaacccttc       960
     ggcggcgcgg cgagcacggg cgatccgatc ttcgtgatcc aggaacatca cgcgcgccgc      1020
     ctgcactacg acttccgcct ggaacacgac ggcgtactcg cttcctgggc ggtgccgaag      1080
     aacctgcccg acgatcccgc ggtgaaccac ctggccgtgc gcaccgagga ccacccgatg      1140
     gactacgccg ccttcgaggg cagcatcccg aagggggagt acggcggcgg cgatgtgagc      1200
     atctgggacc acggcaccta cgaactggag aagtggcgca aggacgaggt gatcgtcacg      1260
     ctgcacggcg cgcgactgcg cggactgcgc tacgccctca tccgcacggg cgaaaagaat      1320
     tggctcgctc acctgaccaa ggacaagacc gcaccggcga aggccgcggc agcgcaagca      1380
     ccggatccga tgctgcccag cgaatccacg atcgaccggc tctccggcga ggattgggcc      1440
     ttcgagggca agtgggacgg ctaccggatc atggcgacgg tgcgcggcgg cgcgctgagc      1500
     ctgcgcaccc gatcgggccg ggttgtcacc ggtgagttcc ccgaattcga gtcactggcc      1560
     cgcgatctcg acggaatgga cgtggtcctc gacggtgaag ctgtagtgct cgacgatgcg      1620
     ggcgtaccgt cgttccacct catggcgggg ggcgagagcc gtaccggcgc ggtacggctc      1680
     tacctgttcg acgtcctcga actgaacggt gtcgacctca ccaagcggcc ctggtcagtg      1740
     cggcgggagg tattggaaag tcttgcacca cttctagatt ccgacgactc gatcggcgtt      1800
     ccagcattgg tcgaggcctc cacgggactg gtggccgcga ccctgagcgc ggaacgggga      1860
     tgggagggga tcgtcgccaa acgtcgcgac tcgccgtatc tgcccggaca gcgggtgcgg      1920
     gcctggctca aacacaagaa ctggcgcgat ctgcaggtgg cgatcggcgg ctggaagccg      1980
     gggaagggtt cgcgcgcgaa ccggatcgga tccgtcctgg tgggtctgcc cgcggagacc      2040
     ggtctggtct atctgggctc ggtggggtcg ggcttgcgcg accgcgatct ggacgcgctc      2100
     gcgcagcgac tggaaccgct gcgaatgaag cgctccccgt tcaccgcctc catcgacgat      2160
     ccggacgctc gcgatgccgt gtgggtgttg cctcaggtgg tgggtgatgt ccgctattcc      2220
     tcgctccgca ggggcgggca cctgcggcag cccagctggc gcggtttccg cgacgatctg      2280
     ctcccgggcg acctccccgg cgaggcggag atcccgtggg aggggcccga cgaataa         2337
//

If you have problems or comments...

PBIL Back to PBIL home page