(data stored in ACNUC1104 zone)

EMBL: CP001966.PE203

CP001966.PE203       Location/Qualifiers
FT   CDS_pept        complement(216477..217037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0203"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mva:Mvan_1927
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76857"
FT                   /db_xref="GOA:D5UQM4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76857.1"
FT                   /translation="MGRWQPDARARLESAALEEFGERGYDTVTVAEIAARAGLTERTFY
FT                   RHFADKREVLFAGQDVLRDLLVERTAEALASAPPWAALERAFTAAAEAIAARDELPLRR
FT                   QTVVEANQALRERELYKLDLIARSLGALLAEHGADGARTLGEASVAAFKVAFEEWVRVP
FT                   GAAPLTQRVAASFATLRRGVAAR"
     atgggacgtt ggcagccgga cgcgcgagcg cgactggaat cggccgcgct cgaggagttc        60
     ggtgagcgcg gctacgacac ggtcaccgtt gccgagatcg ccgcccgcgc cggactcacc       120
     gagcgcacct tctaccggca cttcgccgac aagcgggagg tgctcttcgc gggccaggac       180
     gtactgcgag accttctggt cgaacgcacc gccgaggccc tcgcgtcggc accgccctgg       240
     gcggcgttgg agcgcgcctt caccgcggcc gccgaggcga tcgcggcgcg cgacgagctg       300
     ccactgcgcc gacagacggt ggtcgaggcg aatcaggcac tccgcgagcg ggaactgtac       360
     aaactggacc tgatcgcccg ctccctcggc gctctcctgg ccgagcacgg ggccgacggt       420
     gcccgcaccc tcggcgaagc ttcggtggcc gccttcaagg tggccttcga ggagtgggtt       480
     cgcgttcccg gcgcggcgcc cctgacccag cgcgtcgcag cgtccttcgc gaccctgcgc       540
     cgcggggtgg ccgcgcgcta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page