(data stored in ACNUC1104 zone)

EMBL: CP001966.PE206

CP001966.PE206       Location/Qualifiers
FT   CDS_pept        219880..220659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0206"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmi:MMAR_0086
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76860"
FT                   /db_xref="GOA:D5UQM7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG76860.1"
FT                   /translation="MPRFDVPGAALDTELSDEGGHPVVQLHGLTSSRARDRVLDLDLGR
FT                   GLSGTRLLRYDARGHGRSTGRTVPEDYRWPALADDLLRLLDACFPGERVHGVGPSMGTG
FT                   TLLHAAVRDPGRFSGLTLMVPPTAWATRPAKAAEYRIAADAIEERGLSEFLSAAEDVVS
FT                   PPATNGAPATLPEVTERLLPSVFRGAALSDLPEREALAAIEVPVTLLAWIDDPAHPVST
FT                   AETLAELLPRATLTVARTPADVALWPTVLRDDVARTR"
     atgcccagat tcgacgttcc cggcgccgcg ctcgacaccg aactcagtga cgagggcgga        60
     caccccgttg tacaacttca cggactcaca tccagcaggg cgcgcgatcg agtcctcgat       120
     ctcgatctcg ggcgcggtct gagcggtacc cggctgttgc gctacgacgc gcgcggtcac       180
     ggccgctcga ccgggcgcac cgtcccggag gactaccgct ggccggccct cgccgacgat       240
     ctgctgcggc tgctcgacgc gtgtttcccc ggtgaacgtg tgcacggtgt cgggccgtcg       300
     atgggtaccg gcacgctcct gcacgcggca gtccgtgacc cgggccggtt cagcgggctc       360
     accctcatgg tgccccctac cgcgtgggcc acccgccccg cgaaggccgc cgaataccgg       420
     atcgccgcgg acgcgatcga agaacgagga ctcagtgaat tcctcagcgc cgcagaggat       480
     gtcgtgtccc cgcctgcaac gaacggagcg ccggccaccc tccccgaggt gaccgagcga       540
     ctcctcccgt cggtgttccg cggtgccgcg ctcagtgacc taccggaacg cgaggcgctc       600
     gccgcgatcg aggtcccggt cacgctgctc gcctggatcg acgatccggc gcaccccgtc       660
     tcgaccgccg agaccctcgc cgagctcctc ccgcgcgcca cgctgaccgt cgcccgcacc       720
     cccgcggacg tcgccctgtg gcccaccgtc ctgcgcgacg acgtcgcccg gacgcgctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page