(data stored in ACNUC1104 zone)

EMBL: CP001966.PE209

CP001966.PE209       Location/Qualifiers
FT   CDS_pept        complement(222504..223862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0209"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   art:Arth_3774 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76863"
FT                   /db_xref="GOA:D5UQN0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76863.1"
FT                   /translation="MTIDENVRTVPDRGRLRWFLIGSVALISFSAFESLAVGTVLPRAA
FT                   EQFGATAEYSVAFGAAFAAMIVAIAWVGPWVDRSGVRPPLIAGALLFAAGLLIVGSAPG
FT                   MTVLAVGRGVQGLGSGLISVVLYAMVGRLIPPAGRPRVFAAYSTAWVVPSLVGPAIAGL
FT                   AAGTVGWRWVFLGLAAPSLLALFATLRATTGLDESAYRNDDPPNRGVLFAALAAGTAAA
FT                   VAQFAAPQGGSGFLLLAAAAFVIAVIAARRMLPAGSLIGRPGIPRLMLANLLMAGSFFA
FT                   AEIYVPLYLVHIDRLSPFAAGSVMTGAALLWALASQLQARIPPDGALRERLPLIGSSLL
FT                   TLALVAVATSFAVDAPWPVIFATWAIGGFGMGLTYPTLSILMLGRSADDEQGTNSSALK
FT                   LSDAVGTALAIACTGALFAQVLAWGNSGFAVTLLVPLASGLATVAVTSRLTAE"
     atgaccatcg atgagaacgt ccggaccgtt cccgatcggg gccggctccg ctggttcctg        60
     atcggatcgg tcgcgctgat ctcgttctcc gccttcgagt ccctcgcagt gggaacggtg       120
     ctgccgcggg cggcggagca gttcggcgcc accgccgagt actcggtggc cttcggtgcg       180
     gcgttcgcgg cgatgatcgt ggcgatcgcc tgggtggggc cgtgggtgga ccgctccggg       240
     gtgcggccgc cgctcatcgc cggtgccctg ttgttcgccg ccggcctgct gatcgtgggg       300
     tcggcgccgg ggatgaccgt gctcgccgtc ggtcgtggcg tgcaaggcct gggcagcggc       360
     ctgatcagcg tggtgctgta cgcgatggtc ggccgactga tcccgccggc gggacgccca       420
     cgggtgttcg ccgcgtattc gacggcgtgg gtggtgccgt cgctggtcgg ccccgcgatc       480
     gccggcctcg cggccgggac ggtgggctgg cgctgggtgt tcctcggact ggccgcgccc       540
     tccttgctgg ccctgttcgc gacattgcgg gcaaccacgg ggctcgatga atccgcctac       600
     cgcaacgacg atccgccgaa ccgcggagtg ctgttcgcgg cactggcggc gggaacagcc       660
     gccgcggtcg cgcagttcgc tgcgccgcag ggcggctccg ggttcctgct gctggctgcg       720
     gcagcattcg tgatcgcggt gatcgcggcc cggcgaatgc tccccgccgg atcgctgatc       780
     ggccgtcccg ggattccgcg cctgatgctc gcgaacctgc tcatggccgg gtcgttcttc       840
     gccgcggaga tctacgtgcc gctctatctg gtgcacatcg accggctctc gcccttcgcg       900
     gccggatccg tgatgaccgg cgccgcacta ctgtgggcgc tggcctcgca gcttcaggcc       960
     cgtatcccac cggacggcgc actgcgcgaa cgacttccac tgatcggttc gagcctgctg      1020
     acgctggcgc tggtcgcggt ggcaacatcg ttcgcggtcg acgcaccgtg gccggtgatc      1080
     ttcgcgacgt gggcgatcgg tggattcggc atgggcctga cctatccgac gctgtcgatc      1140
     ctcatgctcg gtcgcagcgc agacgacgag cagggcacga actcgagcgc gctcaagctc      1200
     tccgatgccg tgggcactgc gctcgcgatc gcctgtaccg gagcactgtt cgcacaggtc      1260
     ctcgcgtggg gtaactccgg gttcgcggtc accttgctgg tgccgctcgc ttccgggctg      1320
     gcgacggtgg cggtcacctc gcgcctcacg gccgaatag                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page