(data stored in ACNUC1104 zone)

EMBL: CP001966.PE210

CP001966.PE210       Location/Qualifiers
FT   CDS_pept        223887..225317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0210"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mva:Mvan_4580 H+ antiporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76864"
FT                   /db_xref="GOA:D5UQN1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76864.1"
FT                   /translation="MVEVNREKPVEYAVVRRHRRKVHTDLGSRQHVPRMLRPLLRRDYR
FT                   LLFVTLLCALTTDGMWLVSVVWQVIDMGGSATSVSLVSGAASVGLLVSTLAGGVLADRV
FT                   SQQRILFVLELLKVVVIGGVGVLALTGAITIPLLMAGSLALGLVSGFYFPAYSALVPRL
FT                   VPPDELLAVNGYESAVRPAAAMAVGPAVAAWIIAVASPGAALLVGGAICLFAALWVVRI
FT                   RVPRTEAADEAEPGSPLRELWEGIKYVRQTPWLLATLLFASLMVLVTVGPIDVLLPFAI
FT                   KDQAHGAASEHSMILAAYGFGGVAGALFMAARRMPRRYLTVMMGVWGIASLPMLVFGIA
FT                   ESVWPMVIAGFVLGVLFEAPVVIWGTLLQRRVPRRLLGRVSSLDFFVSLVFMPVSFALA
FT                   GPVSQAIGLTATFVLAALVPVPLAVIAILAARMPQDELAHPLVDEDDEDDGTGAAGDAA
FT                   DAPVTPTVNAPAPEGTVG"
     atggttgagg tcaaccgaga aaaaccggtt gaatacgccg tcgtccggcg gcatcgtaga        60
     aaggtgcata ccgacctcgg ctcccgccag catgtgcccc gcatgctgcg gcctttgctg       120
     cgccgggact accgcctcct gttcgtcacg ctgctctgtg cgctgaccac cgacggcatg       180
     tggctggtct ccgtggtgtg gcaggtgatc gacatgggcg gctcggccac cagcgtctcg       240
     ttggtctcgg gggcggcctc ggtgggtttg ctggtgtcca ccctcgccgg cggtgtgctc       300
     gcggaccggg tctcgcagca gcgcatcctg ttcgtactgg agctgctcaa ggtcgtggtg       360
     atcggtggcg tgggcgtgct cgcgttgacc ggtgccatca cgattcccct gttgatggcg       420
     ggctcgctgg cgctgggcct ggtgtcgggt ttctactttc ccgcgtactc cgcgctggta       480
     ccgcggctgg tcccgcccga cgaactgctc gccgtcaacg gctacgagtc ggcggtacgt       540
     ccggccgccg cgatggccgt cggtcccgct gtcgcggcgt ggatcatcgc cgtcgcctcg       600
     cccggtgccg cgctgctggt gggcggcgcg atctgcctgt tcgccgcgtt atgggtggtg       660
     cggatccgcg tcccgcggac cgaagcggcc gatgaggcgg aacccggttc gccgctgcgc       720
     gagctgtggg agggcatcaa gtacgtgcgc cagaccccgt ggctgctggc gacgctgctg       780
     ttcgcgagcc tgatggtgct ggtcaccgtg gggccgatcg acgtgctgtt gcccttcgcc       840
     atcaaggatc aggcgcacgg cgccgcgagt gagcactcga tgatcctggc cgcgtacggt       900
     ttcggtgggg tggcgggtgc gctgttcatg gcggcccgca ggatgccccg ccgctacctc       960
     acggtgatga tgggcgtgtg gggcatcgcg tcgctgccga tgctggtgtt cggtatcgcc      1020
     gagagcgtgt ggcccatggt gatcgcgggc ttcgtgctgg gcgtgctgtt cgaggctccg      1080
     gtggtgatct ggggcaccct gttgcagcgc cgcgtgccgc ggcggctgct gggccgggtc      1140
     tcgagcctgg acttcttcgt ttcgctcgtg ttcatgccgg tgtccttcgc gctcgccggt      1200
     ccggtgagcc aggcgatcgg tctcaccgcg accttcgtgc tggccgcgct ggtcccggtg      1260
     ccgctcgcgg tgatcgcgat cctggccgcg cggatgccgc aggacgaact ggcccacccc      1320
     ctggtcgacg aggatgacga ggacgacggc acaggtgcgg cgggcgacgc cgccgacgcg      1380
     ccggttacgc ccaccgtgaa cgctccggca cccgagggca ccgtcggata g               1431
//

If you have problems or comments...

PBIL Back to PBIL home page