(data stored in ACNUC1104 zone)

EMBL: CP001966.PE212

CP001966.PE212       Location/Qualifiers
FT   CDS_pept        complement(225659..226672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0212"
FT                   /product="adenylate/guanylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: mab:MAB_4771 putative adenylate cyclase; SMART:
FT                   adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76866"
FT                   /db_xref="GOA:D5UQN3"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032026"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN3"
FT                   /inference="protein motif:PRIAM:4.6.1.1"
FT                   /protein_id="ADG76866.1"
FT                   /translation="MGDAGELDIDELLLPGTREYTFRELAELGGMDIEDLRAWWTSAGF
FT                   ADLRDDDTKAFTRDDVEIVRDLAALFADGVVDADAVVPGSQALGQAMYRLAEWQAPMIR
FT                   HYLEAARADDAPDPASGAALVIDRMDNLQAHIWRRHLAAATQRLMTPEADEEGDITATM
FT                   AVGFADMVGYTRLSRGLAVPELSTLLSTFETRMRTVIYGGGGWIIKGVGDEVMFAADEP
FT                   AAASRIALELQTPHDYPELDAIDLEFPQLRVGMAYGEVLQRYGDLFGNVVNLAARLTSA
FT                   ARPGTVLVDGQLAEAIADVPDLDTRSLRAYRARGFSAVHPHLLRWAKQPKENEDEA"
     atgggcgacg caggcgaact cgacatcgac gagctgctac tgccgggtac gcgtgagtac        60
     accttccgcg agctggcgga gctgggcggc atggacatcg aggaccttcg ggcctggtgg       120
     acctcggcgg gcttcgccga cctccgcgac gacgacacca aggcgttcac ccgcgacgac       180
     gtcgagatag tgcgtgacct cgctgcgctg ttcgccgacg gcgtggtcga tgcggacgcg       240
     gtggtgcccg gatcgcaagc gctgggtcag gcgatgtacc ggctggcgga atggcaggcg       300
     ccgatgatcc ggcactacct ggaagccgcg cgggccgacg acgccccgga cccggcgagc       360
     ggcgccgcgt tggtgatcga ccggatggac aacttgcagg cgcacatatg gcggcggcac       420
     ctcgcggcgg cgacccagcg cctgatgacc ccggaggccg acgaggaggg tgatatcacc       480
     gcgacgatgg cggtgggctt cgcggatatg gtgggctata cccggctcag ccgtggactc       540
     gcggtaccgg agctgagcac cctgctgagc accttcgaga cccgcatgcg cacggtgatc       600
     tacggcggtg gcgggtggat catcaaggga gtgggcgacg aggtcatgtt cgccgccgac       660
     gagccggccg ccgcgtcccg gatcgcgctc gaactgcaga ctccgcacga ctatccggag       720
     ctggacgcga tcgatttgga gttcccgcag ttgcgggtgg gcatggcgta cggcgaagtg       780
     ctgcaacgct acggcgactt gttcggcaac gtcgtgaacc tggccgcgcg gctgaccagc       840
     gcagcgagac cgggcaccgt gctggtcgac ggtcagctcg cggaggcgat cgccgacgtc       900
     ccggacctcg acacgcggag cctgcgggcc taccgcgcac gcggtttcag cgcggtgcac       960
     ccgcatctgc tccgttgggc caagcagccc aaggagaacg aggacgaggc gtga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page