(data stored in ACNUC1104 zone)

EMBL: CP001966.PE218

CP001966.PE218       Location/Qualifiers
FT   CDS_pept        232538..233836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0218"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: rha:RHA1_ro02081 ROK
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76872"
FT                   /db_xref="GOA:D5UQN9"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN9"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADG76872.1"
FT                   /translation="MTVVDIPANSATPTRTAQARAARARNPLTRPAVERAPRVAAPARV
FT                   FPPQLRVSEKPAAAVLRVIRRGGLVLRDEIVRETQLSAATVNRQVTALIEAGLVRERAD
FT                   RAASGVVGRPRLPLEVDPTGPLALGIHIGFRVSTVTMHDVSGKIVGAIQIPTPESGEPG
FT                   EVLSVIATSARRFLARWDGRTILGAGIAIGGRVDDRGVVADHPRLGWKDVALGERLSGA
FT                   IGLPVTVAPHVEAMAAAELHLSESLESQGSTLYFYGRETVGVALALHGAVHSPKSGPHT
FT                   IGHLPTRNVTLLDPRGTGRLEDAVTDTAVVEAAQVQKLAVRTVADLHKLAEGGNATAKA
FT                   IIAERGRVLGEAAALVADIFNPDRLILGGQAFTDYPAILPHVSAALKATSAEPSRAVRV
FT                   SGAGGRVQQQAAGAAALDGVYADPLGAIARATA"
     atgaccgtcg ttgatatccc cgccaattcc gctaccccga cccgtaccgc tcaggcccgg        60
     gccgcacgcg cccgcaaccc gctgaccagg cccgcggtcg agcgcgcccc gcgagtcgcg       120
     gcaccggccc gcgtcttccc gccccagttg cgggtatccg agaagcccgc agccgccgtc       180
     ctccgggtga tccggcgtgg ggggctggtg ctgcgcgacg agatcgtccg cgagacccag       240
     ctctccgctg ccaccgtgaa ccgccaggtc acggctctca ttgaggcggg tctcgttcgc       300
     gagcgcgccg atcgagcggc cagcggtgtc gtcggtcggc cccgtctgcc gctcgaggtg       360
     gacccgaccg gtccgctcgc gctcggcatt cacatcggct tccgagtgag cacggtgacc       420
     atgcacgacg tgtccggcaa gatcgtcggc gcgatccaga tcccgacacc cgagagcggc       480
     gagccgggcg aggtgctctc cgtgatcgcc accagcgcgc gacggttcct ggcccgctgg       540
     gacggccgca ccatcctggg ggccggtatc gcgatcggtg ggcgcgtgga cgatcggggt       600
     gtggtcgccg atcatccacg cctcgggtgg aaggacgttg ctctcggtga gcgcctgtcc       660
     ggagcgatcg gcctgcccgt gacggtggcg ccgcacgtcg aggcgatggc cgccgccgag       720
     ctgcacctgt cggagtcgtt ggagtcgcag ggctccaccc tgtacttcta cggtcgggag       780
     accgtcggcg tcgcgctcgc cttgcacggt gcggtgcatt cacccaagtc gggcccgcac       840
     accatcggtc atctgcccac ccgcaatgtc acgctgctcg acccgcgtgg caccgggcgg       900
     ctcgaagacg cggtgacgga cactgcggtg gtcgaggcgg cgcaggtgca gaagctggcc       960
     gtgcgcaccg tcgccgacct gcacaagttg gccgagggtg gcaatgcgac cgcgaaggcg      1020
     atcatcgcgg agcgcggccg ggtgctgggc gaggcggccg cgttggtggc cgacatcttc      1080
     aaccccgacc ggctgatcct cggcggacag gcgttcaccg actacccggc gatcctgccg      1140
     catgtgtccg ctgcgctgaa ggcgacgtcg gctgaaccca gccgcgccgt ccgggtcagt      1200
     ggtgccgggg gtcgcgtgca gcagcaggcc gccggtgcgg ctgcgctcga cggcgtatac      1260
     gccgatccac tgggcgccat cgcccgcgcc accgcctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page