(data stored in ACNUC1104 zone)

EMBL: CP001966.PE219

CP001966.PE219       Location/Qualifiers
FT   CDS_pept        complement(233733..234827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0219"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: btr:Btr_2350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76873"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP0"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADG76873.1"
FT                   /translation="MTDDDWAAEQQRIAAQFYPGTTVLRNHAGITDPDTLHRYEYQLVE
FT                   RRAIELGDLSRPLLPATFDADHLAAIHRHLFGDIYPFAGQIRDYPLSKDGDNFAHYRNI
FT                   RDYLDAAAYDLRNSPDIRSKDPDRFAHAIADVFAHINTAHPFREGNGRSTRLLIEQAAA
FT                   EFAHFRIDLRTVTREQWNDASKAAHPQPGRFSPDRHRWCRSSAPHSSTHTLSASSPARP
FT                   SRRPRVRLPTDCGLTALQLPVWPAARSPAAPAPTRRAPRRPRSPDPGHRTSVATTPADS
FT                   PVRTSLSAPGLSPQRQGGHRGGDVAQVPVAVREPRCTLCAAGLGVLQFGVRRWRGRWRP
FT                   VDRRIRRRAQPHRRPAAARDPRHH"
     gtgactgacg acgattgggc cgcggagcaa cagcgcatcg cggcccaatt ctatccgggc        60
     accacagtgc tgcgcaacca cgcaggcatc accgaccctg acacgttgca ccgctacgag       120
     tatcagcttg tcgagcgccg ggccatcgag ctcggtgatc tcagccgccc gctactgccg       180
     gccactttcg acgcggatca cctggccgcg atccaccggc acctgttcgg tgatatctac       240
     ccgttcgccg ggcagatccg cgattacccg ttgagcaagg acggcgacaa cttcgctcac       300
     taccgcaaca tccgggacta cctcgacgct gccgcgtacg acctgcgtaa ctccccggat       360
     attcgctcga aggatcccga tcgcttcgcc cacgcgatcg ccgacgtgtt cgctcacatc       420
     aacaccgccc acccgttccg ggagggcaac ggccgctcga cccgcctgtt gatcgagcag       480
     gccgccgccg agttcgcgca cttccggatc gaccttcgca cagtgacccg cgagcagtgg       540
     aacgacgcct cgaaggccgc acacccgcag ccaggccggt tctcccccga ccgacaccgc       600
     tggtgccgat cttccgcgcc gcactcgtcg acccacacac tcagcgcgag cagcccagca       660
     cgaccgtcga gacggccaag ggtaaggctg ccgacggact gtgggctcac ggctctccag       720
     ctgcccgtct ggccggcggc gcgttccccc gcggcgccag cgccgacccg cagagctccg       780
     cgccgaccac gcagccccga ccccggccac cgcacgagcg tggctacgac gccggccgat       840
     agccctgtcc gcaccagcct cagcgcgcct ggcttgtcac cacagcggca gggtgggcac       900
     cgtggcggtg atgtcgcgca ggtgccggta gctgtacgcg agccccgttg cacactgtgt       960
     gcagcggggc tcggcgtgct ccagttcggc gtcaggcggt ggcgcgggcg atggcgccca      1020
     gtggatcggc gtatacgccg tcgagcgcag ccgcaccggc ggcctgctgc tgcacgcgac      1080
     ccccggcacc actga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page