(data stored in ACNUC1104 zone)

EMBL: CP001966.PE220

CP001966.PE220       Location/Qualifiers
FT   CDS_pept        complement(234837..235076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76874"
FT                   /db_xref="InterPro:IPR041535"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76874.1"
FT                   /translation="MTVTTTTDVEVPAWFAHCADLVDGLTTDQRDRVIRTVHSSYLEGM
FT                   DPERDNVEALVRLVRGERTTNQAIDEIKAAFGFG"
     atgactgtca ctacgacgac agatgtagag gtccctgcgt ggtttgcgca ctgcgctgac        60
     ctggtcgacg ggctcaccac tgatcagcgg gaccgggtga tccgcaccgt ccattcgagc       120
     tacctcgagg gaatggatcc cgagcgtgac aacgtagagg cgttggtgcg cctggtccgg       180
     ggcgaacgca ccacgaatca ggccatcgat gagatcaagg cagccttcgg cttcgggtga       240
//

If you have problems or comments...

PBIL Back to PBIL home page