(data stored in ACNUC1104 zone)

EMBL: CP001966.PE223

CP001966.PE223       Location/Qualifiers
FT   CDS_pept        238083..238316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76877"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76877.1"
FT                   /translation="MAITRGTERFALLAEQTQAAARRRGIAVTDEVIDQILNAEIERVA
FT                   KLMGIEPRTALLYTPADLPLTLAEMIAATHHQ"
     atggcgataa cgcgaggcac cgagcggttc gcgctgctgg cggagcagac gcaagccgct        60
     gcccggcgac gggggattgc ggtcaccgac gaggtgatcg atcagatcct caacgccgaa       120
     attgagcggg tggccaagtt gatgggaatc gaacctcgca cagccctgct atacacgcct       180
     gcggatctgc cgctgacgtt ggcagagatg atcgcagcca cccaccacca gtaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page