(data stored in ACNUC1104 zone)

EMBL: CP001966.PE227

CP001966.PE227       Location/Qualifiers
FT   CDS_pept        complement(241483..241869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0228"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76881"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP8"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADG76881.1"
FT                   /translation="MLLGMDRETVTATEFNRRPSEILARAVDGALVEVVRQGRPVAWVG
FT                   PLDLLEGLLARESEIEMTDDQFEALMTGVNGVRTAILELAEATDKASKRLATAADQSDS
FT                   VRAATTSRATNAIEDLVASLNRRA"
     atgctgctgg gcatggaccg agagacggtg acagcgacgg agttcaatcg ccgcccaagt        60
     gagatcctcg cgcgggcggt agacggcgct ctggttgaag tcgtgcggca gggacggcct       120
     gttgcgtggg tcggtccact ggatctgctc gaaggcttac tggcacggga aagtgagatt       180
     gagatgactg atgatcagtt cgaagcgttg atgacaggcg tcaatggggt acgtactgca       240
     atcctcgaac tcgcagaggc cacggataag gcgtcgaagc ggctcgcaac agcggcggat       300
     cagagtgact ccgtgcgtgc cgccacgacc tcccgtgcaa ccaacgcgat cgaagatctg       360
     gtcgcttcgt tgaaccggcg cgcatag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page