(data stored in ACNUC1104 zone)

EMBL: CP001966.PE228

CP001966.PE228       Location/Qualifiers
FT   CDS_pept        complement(241967..243022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0229"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   aau:AAur_1451 domain of unknown function (DUF323) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76882"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP9"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADG76882.1"
FT                   /translation="MTDEQKSSCCGTTANAPRTSAGDVGGGRHAAAPDETVAAQARRSV
FT                   VPTPAAAQTAHAVHDSRQVSIGPKPFLMGDFTGAGIAADEEGPAHPVGVSAYSIDATTV
FT                   TNAQFARFVDATGYRTTAQQRGSSTVFYSQVAPSATVLDVPDPQAWWWRTVEDAYWRNP
FT                   FGAGSTAENRPDHPVVHISYFDALAYCAWANRTLPTEAQWECAARGTILGETYPWGGQP
FT                   PIDGEPLKVNIFRGAFPDQPTTPVGTMPVTSLPPNDIGIYHSVGNVWEWTADAYVPGLY
FT                   AQRAATTLGPAGTAVDPRSPGDTDRDDFMLRGGSYLCHDSYCNRYRNSARTHATPHTST
FT                   SHIGFRTTAPM"
     atgaccgacg agcagaagtc ctcgtgctgc ggaaccactg ccaacgcccc ccgcacgagc        60
     gctggtgatg tgggcggtgg tcggcacgct gctgccccgg acgagaccgt agcggcccag       120
     gcacgccgaa gtgtggtgcc gactccggca gcggcgcaga ccgcccacgc ggtgcacgat       180
     agtcggcagg tcagtatcgg ccctaaaccg tttttgatgg gcgatttcac cggggcggga       240
     atcgccgcgg acgaggaggg gcccgcgcac ccggtgggtg tgagcgcata cagcatcgac       300
     gcgacaacgg tcaccaacgc gcagttcgcc cggttcgtcg atgccaccgg ataccgcacc       360
     accgcgcagc agcgaggctc gtcgacggtc ttctactcac aggtcgcccc ctccgccaca       420
     gtgctcgacg tgccagaccc gcaggcgtgg tggtggcgaa ccgtcgaaga cgcgtactgg       480
     cgcaacccct tcggtgcggg aagcaccgcc gagaaccgcc ccgaccaccc cgtcgtacac       540
     atctcctact tcgacgccct cgcctactgc gcctgggcca accgaacgtt gccgaccgaa       600
     gcacagtggg aatgcgctgc acgcggaaca attctcggcg aaacctaccc gtggggcggt       660
     caacccccca tcgacggcga accactgaaa gtcaacatct tccgcggcgc cttccccgac       720
     cagccgacca caccagtagg cacgatgccc gtgacatccc taccgcccaa cgacatcggc       780
     atctaccaca gcgtaggcaa cgtctgggaa tggaccgccg acgcctacgt accaggcctg       840
     tacgcccaac gagccgccac caccctcggg cccgccggga ccgccgtcga cccccgctcc       900
     cccggcgaca ccgaccgcga cgacttcatg ctccgcggcg gcagctacct ctgccacgac       960
     agctactgca accgctaccg caacagcgcc cgcacccacg ccaccccaca taccagcacc      1020
     agccacatcg gattccgcac cacagccccc atgtag                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page