(data stored in ACNUC1104 zone)

EMBL: CP001966.PE229

CP001966.PE229       Location/Qualifiers
FT   CDS_pept        complement(244120..244413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0231"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mlu:Mlut_10240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76883"
FT                   /db_xref="GOA:D5UMQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76883.1"
FT                   /translation="MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVK
FT                   TADVEAGSKSGSSAAQSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK"
     gtgcctaagc cgtatccgaa ggagttccgc gacgatgtgg tccgtgtcgc gcgtaatcgt        60
     gagccgggag tccgtctcaa gcagatcgct gccgacttcg gcattagcga gtcgtgcctg       120
     atgaactggg tgaagaccgc cgatgtcgag gccggctcca agtccgggag cagtgcggcg       180
     cagtcggcga ccgagaggca aatgcgtaag cggattcggc tccttgagca ggagaatgag       240
     gtcctgcgtc gtgcggctgc gtatctgtcg caggcgaacc tgccgggaaa atga             294
//

If you have problems or comments...

PBIL Back to PBIL home page