(data stored in ACNUC1104 zone)

EMBL: CP001966.PE232

CP001966.PE232       Location/Qualifiers
FT   CDS_pept        248791..249426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0236"
FT                   /product="GAD-like domain protein"
FT                   /note="PFAM: GAD-like domain protein; KEGG: pst:PSPTO_2458
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76886"
FT                   /db_xref="InterPro:IPR014983"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ3"
FT                   /inference="protein motif:PFAM:PF08887"
FT                   /protein_id="ADG76886.1"
FT                   /translation="MTDDHFELFLRDVPLTTAGPACTQQHLDTYRGVLPNPLLSYWQEY
FT                   GFSGFGDGIVWLTDPLEWQATTTLITAGITHRPLGTDATYIPILRTAFGKIWFWTPGFG
FT                   RSLTITPAVGTASCIIQSAPRDLSLQATFATGDRERYDFDPKGFPGGLFEQVLTRCGPL
FT                   TVDQVYHFTPSIVSDDDPVDISTAQVANIHEWLAAVKTEVGDWSTFYI"
     atgactgacg accacttcga gcttttcctc cgcgatgttc cgctcaccac tgctgggccg        60
     gcctgcacgc agcagcatct cgacacctac cgcggtgtac tgcctaaccc cttgctgtcc       120
     tactggcagg aatacggctt ctccggcttc ggcgacggca tcgtctggct caccgatcct       180
     ctcgagtggc aagcaaccac caccctcatc accgccggca tcacacaccg ccccctcggc       240
     accgacgcca cctacatccc catcctccgc accgccttcg gtaagatatg gttctggacg       300
     cccggattcg gtcgatccct gacaattacc ccagccgtcg gaacggcgag ctgcatcatt       360
     caatcagccc cgcgcgacct tagccttcaa gcaacattcg cgacaggaga tcgtgaaagg       420
     tatgattttg atccgaaagg ttttcctggc gggttgttcg agcaggtgtt gacgcggtgc       480
     gggccgctca ccgttgatca ggtgtatcac ttcactccgt cgatagtcag tgatgatgat       540
     ccggtcgaca tcagcactgc tcaagttgca aatattcacg aatggctcgc ggcagtgaaa       600
     acagaagttg gcgactggtc gaccttctac atctaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page