(data stored in ACNUC1104 zone)

EMBL: CP001966.PE233

CP001966.PE233       Location/Qualifiers
FT   CDS_pept        249520..250155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0237"
FT                   /product="GAD-like domain protein"
FT                   /note="PFAM: GAD-like domain protein; KEGG: pst:PSPTO_2458
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76887"
FT                   /db_xref="InterPro:IPR014983"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ4"
FT                   /inference="protein motif:PFAM:PF08887"
FT                   /protein_id="ADG76887.1"
FT                   /translation="MTDEHFELFLRDVPLTTAGPACTQQHLDTYRGVLPNPLLSYWQEY
FT                   GFSGFGDGIVWLTDPLEWQATTTLITAGITHRPLGTDATYIPILRTAFGEVWFWTPGFG
FT                   KSLVVAPVNATAVCTGLSRPNDLSLQSIFAMGSPSRYDFKPLGFPDGVFTRVLAQCGKL
FT                   DFDQVYHFNPSVIHDEDSVDIGTAEVADIHPWLAEVKDSVGEWPTAYI"
     atgactgacg agcacttcga gcttttcctc cgtgatgttc cgctcaccac tgctgggccg        60
     gcctgcacgc agcagcatct cgacacctac cgcggtgtac tgcctaaccc cttgctgtcc       120
     tactggcagg aatacggctt ctccggcttc ggcgacggca tcgtctggct caccgatcct       180
     ctcgagtggc aagcaaccac caccctcatc accgccggca tcacacaccg ccccctcggc       240
     accgacgcca cctacatccc catcctgcgc accgccttcg gcgaagtatg gttttggacg       300
     cccggattcg ggaaatcgct agtcgttgct ccggttaatg ctacggcagt ttgtacagga       360
     ctatcccgcc cgaatgatct gagcctccag tcgatattcg cgatgggcag tccgtcgaga       420
     tatgacttta aaccgttggg gtttcctgac ggtgtgttca cccgggtcct agcgcagtgc       480
     gggaagcttg atttcgatca ggtatatcac ttcaacccgt ctgtgattca tgatgaggac       540
     tccgtcgata tcggcactgc cgaggtagca gatattcacc cgtggctcgc tgaagttaag       600
     gactctgtcg gcgaatggcc gacggcttat atctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page