(data stored in ACNUC1104 zone)

EMBL: CP001966.PE235

CP001966.PE235       Location/Qualifiers
FT   CDS_pept        251541..251834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0239"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   mbt:JTY_1281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76889"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ6"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ADG76889.1"
FT                   /translation="MTEDQSASAHLYEIAAGPAARRALRRLPTKVAAAIVEFITGPLAD
FT                   NPHRLSKPLRNEYDGYRSARRGDYRVLLRVDNSTRRVLIIDIDHRAHIYRPR"
     gtgaccgagg accaatcggc tagcgcgcat ctctatgaga tagctgccgg cccggcagcc        60
     cgtcgcgccc tacgccgact accgaccaag gtcgccgcag cgatcgtaga gttcatcacc       120
     ggcccactcg cggacaatcc gcaccggctc agcaaaccgc tgcgcaacga atacgacggc       180
     taccgcagcg cccgccgcgg cgactaccgc gtcctgctac gcgtcgataa cagcactcga       240
     agggtgctca tcatcgacat cgatcaccgt gcacacatct accgacctcg gtag             294
//

If you have problems or comments...

PBIL Back to PBIL home page