(data stored in ACNUC1104 zone)

EMBL: CP001966.PE242

CP001966.PE242       Location/Qualifiers
FT   CDS_pept        complement(256567..259257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0246"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   sen:SACE_4230 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76896"
FT                   /db_xref="GOA:D5UQR3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR3"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ADG76896.1"
FT                   /translation="MVLSRSIAPEDCCIDSRGYFFYELPLYLRGGRDGDVSANRFSIPC
FT                   SDEWTSVLVNGWMNYVPPDARLPDQGWKIHVSTVPSQAAQVLARVADVCLRRGLPFKHL
FT                   PDMAAVVRSNAKYADRGGSGKFITIYPRQEDVELESLLVELEDQLASFVGPYILSDIRW
FT                   RDSPVFLRYGGFRSRTAVIDGESVAVIRDDESRDVPDHRVPYFMPPSRSKIPEFLRDIV
FT                   DSRVGGVSLITGHDFPYEVISAMHFANSGGVYLARHRDAPDTNVVLKEGRPHVAVDPAT
FT                   GNDAADRLLVEYNALVALRSVPGIVDAQRTFQAGGHRFVQIDFVDGNTLYDWVARNFPY
FT                   PTTASVDDYVCEALSIANQVSEAVREAHRRGYALVDVQPRNIFVDYDPELPNASLRVTL
FT                   IDLELAHSIFNDTGSPPPARFIGTPGFVSGIDDEFSAQQRDGYAVVRSIVHMFHPVTPL
FT                   SSVSDTLWDGQKKYIRDVFGTQSVEAIERIDAIFGSPLQRSVARARAAAVRSAWLPSCS
FT                   NSKEVRADLVTGILRSRTASRDDCVYPGSPAMYGTALGLASVGHGAAGVMLMLNRQAPC
FT                   VRQRRVFVAELDQFQALYQSSEDFSLLTGRTGMACALWELGAPRESVSALVSGCAGAAR
FT                   RSGRYGLADGAGGIAAAVASICQSGGDSSIASEIAELADTLTAGPAVERALNGSPGLFD
FT                   GMAGLAVGLLLLSLCPGVDAAALRSSGRTLVDAAVDTLVEAPDGSLHVRSRGALYPYLG
FT                   SGSAGVGVAVAVMHQLTGEPLTADHVHVLHRVRRACHVRSCLYPGLLKGMSGLLVAERM
FT                   FTELLGPPRTAMNPLELLAPFLFHSPSGLLSSGDGGRRLAVDYAHGAAGLLPALADSSH
FT                   LLDWLPVANPHRLLSPRTSQPITIN"
     gtggtgctgt caagatccat tgcaccggag gactgttgta ttgactcccg cggctacttc        60
     ttctacgaac ttcctctgta cttgcgcggt ggccgtgatg gggacgtgag cgcgaatcgg       120
     ttttcgattc catgcagtga tgaatggaca tcggtgctgg tcaacggctg gatgaactat       180
     gttccgccgg atgctcgtct tcctgatcag gggtggaaga ttcacgtcag tacggttccg       240
     agtcaggctg ctcaggtgct tgcacgggtg gccgatgtct gtcttcgccg cggcttacct       300
     ttcaagcacc ttcctgacat ggccgcagtc gtccggagca acgccaagta cgcggatcgt       360
     ggcggatcag ggaaatttat taccatatac cctcgccaag aagatgtgga gcttgaatcg       420
     ctgctggtcg aacttgagga tcagttggcg agctttgtgg ggccatacat actatccgat       480
     attcgctggc gcgatagtcc tgtgtttctg cgatatgggg gattccgttc gcgaacggcc       540
     gttattgatg gggagtcggt ggcggttatc cgcgatgacg agtcgcgcga tgtgcccgat       600
     catcgtgtcc cgtatttcat gccaccgtcg cgctctaaaa tccctgaatt tttgcgggat       660
     attgtggatt cccgcgttgg tggtgtctct ctgattacag ggcatgactt tccgtacgaa       720
     gtcatctcgg cgatgcattt cgcaaactcc ggcggcgttt acttggcgag acacagggac       780
     gcgccggata ccaatgttgt gctgaaggaa ggtcgtccgc acgttgcggt tgatccggcg       840
     actggcaatg atgccgcaga tcgtctactg gtggagtaca atgcacttgt cgcgcttcgg       900
     tctgtgcccg gaatcgtcga tgcgcaaagg acgtttcagg caggtgggca tcggtttgtt       960
     cagatcgact tcgttgacgg gaacactctc tacgactggg tggcacggaa ttttccgtat      1020
     cctacgactg cctctgtcga cgattacgtg tgcgaggcat tgagtatcgc caaccaagtc      1080
     agtgaggcgg ttcgcgaagc ccaccgtagg gggtatgcgc ttgtagatgt acagccgcgc      1140
     aatattttcg ttgactatga tcctgagcta ccgaacgcct ccttgcgtgt cacgctcata      1200
     gatcttgagc tcgcacattc gattttcaac gatactgggt cgccgccgcc agctcgattt      1260
     atcggcacgc cgggtttcgt atctgggatc gacgacgagt tcagcgcgca gcaacgggac      1320
     gggtatgccg ttgtcaggtc gatcgttcat atgttccacc ccgtgactcc gctatcctca      1380
     gtaagcgata cgctttggga cgggcagaag aaatacattc gtgacgtatt cggcacacag      1440
     agcgttgagg cgatcgaacg tattgacgct attttcggct cgccactcca gcgatctgtt      1500
     gcgcgtgcgc gggcggcggc tgtgcgttcg gcgtggctgc cgtcgtgctc caactctaag      1560
     gaggttcgcg cagaccttgt cacgggcatt cttcgatccc gcaccgcgag tcgagacgat      1620
     tgtgtctacc cggggtcgcc ggcgatgtac ggcaccgcac tcggacttgc gtctgttgga      1680
     catggcgctg ccggtgtgat gcttatgctc aaccgacagg ctccgtgcgt gcggcagcgt      1740
     cgcgtgttcg tagcggagct cgatcagttc caggcgctgt accagtcttc ggaagatttt      1800
     tcattgctga cgggccgaac cggaatggcc tgcgcgctgt gggagctcgg cgcaccacgg      1860
     gagtctgtga gcgcgctcgt atcggggtgc gccggcgcgg cccgacgctc cggacgctac      1920
     gggctggccg acggtgcggg cggaatagcg gccgcagtgg cctcgatctg ccagagcggc      1980
     ggcgacagtt ccatcgcgtc cgaaatcgcg gaactagcgg atactctgac tgccggccct      2040
     gctgtggagc gagcattgaa tggctcccca gggttgttcg atgggatggc cgggctggcg      2100
     gtgggcctgt tgttgctgtc tctgtgccct ggggtggatg cggccgcgct gcgctcgtcc      2160
     ggccggacgc ttgtcgatgc ggcggtcgat actctggttg aggctccgga cggctcgctg      2220
     cacgtgcggt cgcgtggtgc cctgtatccg tatctgggca gcgggtcggc gggggtgggt      2280
     gttgctgtcg ctgtcatgca tcagttgacg ggcgaaccgt tgaccgcgga ccatgtgcat      2340
     gttctgcatc gggttcggcg agcctgtcac gttcggtctt gcctgtaccc aggcctgctc      2400
     aaaggcatgt ccggcttact cgtcgcagaa cggatgttca ccgagctact gggcccgccg      2460
     cgaacagcta tgaatccgct tgaattgctg gcacctttcc tgtttcacag ccccagcggt      2520
     cttttgtcct ccggcgacgg aggacggcgt ctggcggtgg actacgcaca cggtgctgct      2580
     ggtctgctgc ccgcgctagc tgactcgtcg catctattgg attggcttcc tgtagcgaat      2640
     ccacatcgtc tgttgtcgcc tagaacaagc caaccgatca ccatcaacta g               2691
//

If you have problems or comments...

PBIL Back to PBIL home page