(data stored in ACNUC1104 zone)

EMBL: CP001966.PE243

CP001966.PE243       Location/Qualifiers
FT   CDS_pept        complement(259624..259848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76897"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76897.1"
FT                   /translation="MNQIRRRIAGVGAAAAIVLSGGFLAAPIASADHVSDCYALYDSTV
FT                   DYCNGIAASGRDAAPCFYAARENLRQCLS"
     gtgaaccaga tccgtcgacg aattgcggga gtaggggccg cggcagcgat cgttctctcg        60
     ggcggcttcc tcgccgcacc catcgcgagc gctgaccacg tctccgactg ttacgccctg       120
     tatgacagca cagtggacta ctgcaacggc atcgcggcgt ccggcaggga tgcggcgccg       180
     tgcttctacg ctgctcgtga gaatctgcgg cagtgcctga gctag                       225
//

If you have problems or comments...

PBIL Back to PBIL home page