(data stored in ACNUC1104 zone)

EMBL: CP001966.PE245

CP001966.PE245       Location/Qualifiers
FT   CDS_pept        260842..261657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0249"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: nfa:pnf160
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76899"
FT                   /db_xref="GOA:D5UQR6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR6"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADG76899.1"
FT                   /translation="MTDDSTSPAGGNAADERPRRRPWWQLYEANSLVGLAFAGMLWVVA
FT                   FSAYLMAPQDDYQVGQASAPAVIGFLILGLIVVALVVGITIMFGASVREVRRRLGFTRP
FT                   RGRAGWRWAWILVAIGLGIVIRMELVPAIGDLWPSIKIQSDAQRAADDLRDLQLAAPAW
FT                   MVWTHAAGEELIFRCPVVAAAVWAFGDGPLRWRQVPRVCVAVVAAVVAVTSVLFGLAHV
FT                   EFSWYNVAAAGVMGLACAVVAVVTRSIWPAAALHAAYNTFSIASMTRLW"
     gtgaccgacg acagcaccag tcccgcgggc ggtaacgcgg cagacgaacg gccacggcgt        60
     cggccctggt ggcagcttta cgaggcgaac agcctggtcg ggcttgcctt cgctggcatg       120
     ctctgggtgg tcgcgttttc ggcgtacctg atggctcctc aggacgacta ccaagtcggt       180
     caggcatctg ccccggcggt catagggttc ctcatcctgg gcttgatcgt ggtggccctt       240
     gtcgtgggca tcacgatcat gtttggcgcg tccgtgcgcg aggtgcggcg gcggctcggg       300
     ttcacgcgtc cgcggggccg cgcgggatgg cgctgggcat ggatcctggt cgctatcggc       360
     ctggggatcg tgatccgcat ggagctcgtt cccgccattg gagatctgtg gcccagcatc       420
     aagatccaga gcgatgcgca gagggcggcc gatgatctcc gagatctcca gctggccgcc       480
     ccggcgtgga tggtctggac tcacgccgcg ggcgaggaac tgatatttcg atgcccggtc       540
     gtcgccgcgg ctgtgtgggc tttcggtgac gggcctctgc gttggcgtca ggtgccgcgc       600
     gtgtgcgtcg ctgtggtcgc cgccgtggtg gcggtgacgt ctgttctgtt tgggctcgca       660
     cacgtcgagt tcagctggta caacgtggcc gctgccggcg tgatgggact cgcctgcgca       720
     gtcgtcgcag tcgtcacccg gtcgatctgg cccgcggccg ccttacacgc cgcatacaac       780
     acgttctcga tcgcttcgat gacgcggctc tggtga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page