(data stored in ACNUC1104 zone)

EMBL: CP001966.PE246

CP001966.PE246       Location/Qualifiers
FT   CDS_pept        261721..262053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76900"
FT                   /db_xref="GOA:D5UQR7"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76900.1"
FT                   /translation="MATFLNVFGTLLTCWLYALIFGGVVMLVWWVLPRPILYALARRGS
FT                   GPAVAVLRVARVFERAYFIVLFPVLLVLFLLPLNNPRLQANIIYTFWASRELGAYSRRR
FT                   RASRPF"
     atggccactt tcctgaacgt cttcgggacg ctgctgacgt gttggcttta tgccctgatc        60
     ttcggtggcg tggtgatgct ggtgtggtgg gtcctcccgc gcccgatcct ttacgcgctc       120
     gctcgccgcg gcagtggccc ggcggtcgcg gtgctgcggg tggcgcgtgt cttcgagcgt       180
     gcgtacttca tcgttctgtt tccggtgctg ctcgtgctgt tcctgctgcc gctgaacaat       240
     ccgcggttgc aggcgaacat catctacacc ttctgggcct cgcgcgagct gggcgcctac       300
     tcgcggcgcc ggcgcgcaag ccgcccgttc taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page