(data stored in ACNUC1104 zone)

EMBL: CP001966.PE249

CP001966.PE249       Location/Qualifiers
FT   CDS_pept        264528..267401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0253"
FT                   /product="TrwC relaxase"
FT                   /note="PFAM: TrwC relaxase; KEGG: car:cauri_pET4482726 TraA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76903"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS0"
FT                   /inference="protein motif:PFAM:PF08751"
FT                   /protein_id="ADG76903.1"
FT                   /translation="MLGRGERPVMTIHVLHAGDGYTYLTRNTASGDRVREGRDQLSAYY
FT                   LEGGTPPGRWHGRGLAALAAHSPASEHATGPVAGQVTEAQMKALFGEGLHPDADAMMKA
FT                   GASVKDVKLGNKFPVFANEIPVLVAFNTAVKEHEREHGAAPSKEVRDALWKQVARTEFE
FT                   RANPNEPGADDKRVLAWAAKEKGKVRQPVAGYDLTFTPVKSVSVMWALADPETRAKIET
FT                   AHQAAVGDALSWLEDNAVFTKRGARGEQQLSTAGLTVAQFDHYDTRAGDPNLHTHCAVS
FT                   NKVLGSDGRWGAINSLPFFNNAVAASQRYNAVLAETLRAELGVEFVARQVGRGKQPIME
FT                   IAGIDTALLDGFSTRRAQVRARHEQLLAQYIADHGHTPGKHAEYALFQQATLETREGKD
FT                   VGPEGSGSLGKQLTAWQSKARALAPEQAQGEQLLAQCRIAGREALAAISNDPDAAPDRA
FT                   WHGPAAAAEEVLHKVCEQRSVWRETHLRTAAEAIIAAKLLPSGSDRRELVDTVVERALA
FT                   ESMIVGPGHELLDTTTGEIPERLRRDNGEHVLTNPGGPLLTSSRIVDAENTILDAAATP
FT                   TAHVATNAVIDAGIASVEENEPFPLNAGQAELVRHFCGSGALVAAGVGPAGTGKTTSMK
FT                   ATVAAWTADANRLPGAAVNRQVIPLAPSAVAATKLGDEIELTGNTIDSFTYWWTAMGGR
FT                   ETYLTAHQVLADPDAGFLARRDARDALKRCPTGAMYLVDEAGMASTRNLAIMVDIAEQT
FT                   GGVVRFLGDPYQLDAVTTGGAFAMLARATDAPELTDVVRFGTDTQQAENSLALRAGDEA
FT                   ALDLYEQRGWTHHHNTAGEAIDEMVAAHLADTASGRNSIVLASTREEVAAINAQIQAHH
FT                   RSGGRAQAGRTVDLSDGLAAGVGDRIVTRDNDSDYRQIGGKRANSRVLNGDLWNVEKIH
FT                   SDGSLTARHIEDGGRIHLPASYLTANT"
     atgttggggc gcggtgaacg ccctgtgatg accatccacg tcctgcacgc aggcgacggc        60
     tacacctacc tcacccgcaa caccgcctcc ggtgaccggg tccgggaagg ccgcgatcag       120
     ctctccgcct attacctcga aggcggcacc ccgccgggcc gttggcacgg ccgcggcctg       180
     gccgccctgg cagcccactc ccccgcctcc gaacacgcca cagggccggt cgctgggcag       240
     gtcaccgagg cgcagatgaa ggcactgttc ggcgagggcc tgcacccgga cgcggacgcc       300
     atgatgaagg ctggcgcgag cgtcaaagac gtcaagctag gcaacaagtt cccggtcttc       360
     gccaatgaga tcccggtgct cgtcgcgttc aacaccgccg tcaaggagca cgagcgtgag       420
     cacggcgctg cgccatcgaa ggaggtccgc gacgcgctgt ggaagcaggt cgcccgcacc       480
     gaattcgagc gtgccaaccc caacgaacca ggcgcagacg acaagcgtgt cctggcctgg       540
     gccgcgaagg agaagggcaa ggtccgccag cccgtcgcgg gctacgacct gaccttcacc       600
     ccagtcaaga gtgtgtcggt gatgtgggcg ctcgccgacc ccgaaaccag ggccaagatc       660
     gagaccgcgc accaggccgc cgtgggcgat gccctgtcgt ggctcgaaga caatgcggtg       720
     ttcaccaagc gtggcgcgcg cggtgaacag cagctcagca ccgccggtct gacggtggcg       780
     cagttcgacc actacgacac ccgcgcaggg gatccgaacc tgcacaccca ctgcgccgtc       840
     tccaacaaag tcttaggctc cgacggccgg tggggcgcga tcaacagcct gccgttcttc       900
     aacaacgccg tcgccgcgtc gcagcggtac aacgcggtcc tggccgagac cctccgtgcc       960
     gagctggggg tggagttcgt ggcgcggcag gtcgggcggg gtaagcagcc gatcatggag      1020
     atcgcgggca tcgacacggc cctgctcgac gggttttcca cccgtcgtgc acaggtccgc      1080
     gcgcggcacg aacagctgct cgcgcagtac atcgccgacc acggccacac ccccggcaag      1140
     cacgccgagt acgccctgtt ccagcaggcc accctcgaaa cccgcgaggg caaagacgtc      1200
     ggccccgaag gttccgggag cctcggaaaa cagctcactg catggcaatc caaggcccgc      1260
     gctcttgccc ccgagcaggc ccaaggcgag caactgctcg cccagtgccg cattgcaggg      1320
     cgcgaagcgc tcgccgcgat ttccaacgat ccggatgccg cacccgatcg ggcctggcac      1380
     ggccccgccg ccgcggccga ggaggttctc cacaaggtct gcgagcagcg atccgtctgg      1440
     cgcgaaacgc acctgcgcac cgccgccgag gccatcatcg ccgccaagct cctcccctca      1500
     ggatccgatc gccgcgagct cgtggacacc gtcgtcgaac gggctcttgc tgagtcgatg      1560
     atcgtcggcc ccggccacga actcctcgac accaccaccg gagagatccc cgaacgtctt      1620
     cgccgtgaca acggtgaaca cgtcctcacc aaccccggcg gcccgctgct gacgagcagc      1680
     cgcatcgtcg acgccgaaaa cacgatcctc gacgctgccg ccacccccac cgcgcacgtc      1740
     gccaccaacg cggtcatcga cgccggcatt gcctccgttg aggagaacga gccgttcccg      1800
     ctcaatgccg gccaagccga actggtgcgg cacttctgcg gctccggagc cctcgttgcc      1860
     gccggtgtcg gccctgccgg cactggcaaa acaacgtcga tgaaggccac cgtcgctgcc      1920
     tggaccgccg acgccaaccg gctacccggc gccgccgtga accgtcaggt catccccctc      1980
     gcaccgtccg cggttgcggc cacgaagctc ggtgatgaga tcgagctgac gggcaacacc      2040
     atcgactctt tcacctactg gtggaccgcc atgggcggcc gcgaaaccta cctcaccgcg      2100
     caccaggttc tcgctgaccc cgacgccggc ttcctcgccc gccgcgatgc tcgcgatgcc      2160
     ctgaaaaggt gcccgaccgg tgcgatgtac ctggtcgacg aggccggtat ggcatcgacc      2220
     cgcaaccttg cgatcatggt cgatatcgcc gagcagaccg gcggcgtcgt ccggttcctg      2280
     ggcgacccgt accagctcga cgccgtcacc accggcggcg cgttcgccat gctcgcgaga      2340
     gccaccgacg cccccgaact gaccgacgtc gtccggttcg gcacagacac gcagcaagcc      2400
     gagaattcgc tcgccctgcg cgccggtgac gaggccgcac tcgacctcta cgaacagcgc      2460
     ggctggaccc accaccacaa caccgccggt gaggcgatcg acgagatggt cgccgcgcac      2520
     ctcgccgaca ccgcctcggg gcgcaattcc atcgtcctgg cgtccacccg tgaggaagtc      2580
     gcggcgatca acgcccaaat ccaggcccac caccgcagcg gcggcagagc ccaagccggg      2640
     cgaaccgtgg acctctccga cggtctcgcc gccggtgtcg gagaccggat cgtcacccgc      2700
     gacaacgact ccgactaccg ccagatcggc ggcaaacgcg ccaacagtcg cgttctcaac      2760
     ggtgacctat ggaacgtcga gaagatccac tccgatggct cgctgaccgc ccgccacatc      2820
     gaagacggcg gccgcatcca cctgcccgcc agctacctca ccgcgaacac ctga            2874
//

If you have problems or comments...

PBIL Back to PBIL home page