(data stored in ACNUC1104 zone)

EMBL: CP001966.PE253

CP001966.PE253       Location/Qualifiers
FT   CDS_pept        269213..269518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76907"
FT                   /db_xref="GOA:D5UQS4"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76907.1"
FT                   /translation="MTMPLNYPPPPSPSLGECLTYALAASVLTAAGALLVAVVSMVQVR
FT                   RSRRRLVGAGVAMTDQERSTAVNAIRQLRVIRAHALVSFGFCVAVAGSCALARSLL"
     atgacgatgc cacttaacta cccaccccca ccttccccat cacttggcga gtgcctgaca        60
     tacgcgctgg ctgcctccgt gttgacggcg gcgggcgcgc tgctggtggc tgtggtgagc       120
     atggttcagg ttcggcgctc caggcggcgc ctagtcggtg ccggggtcgc gatgaccgat       180
     caggagcgca gcaccgctgt caacgcgatc cgacagcttc gagtgatcag ggcgcacgcc       240
     ctggtgagct tcgggttctg cgtggccgtg gccggttcgt gcgcgctggc gcggtcattg       300
     ctgtag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page