(data stored in ACNUC1104 zone)

EMBL: CP001966.PE256

CP001966.PE256       Location/Qualifiers
FT   CDS_pept        270155..270730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76910"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76910.1"
FT                   /translation="MQGLNERSPDNGGEAVAAHLREVLDMLAAPALVREQVVFASSVRM
FT                   WPPRPGWDRTPGIGSIRLWTDCDLLAWFDAAAADGVALFGQQSRDEIRALTQATAMARM
FT                   CGEGAKAIWGLDVLGPGDYSPIPTSMKRVLWANDLVCFGPQLTEEQTAQIQAHLDDGHD
FT                   GHGRQETNAPVAVHGTECFATVWMGGTA"
     atgcagggat tgaatgagcg atcaccggat aacggcggcg aggccgtcgc ggcgcatctg        60
     cgggaggttc tggacatgct ggccgcgcca gcgttagtgc gggagcaggt ggtcttcgcc       120
     agcagtgtcc ggatgtggcc gccccgcccg gggtgggacc gcacgccggg tatcggcagt       180
     atccggctgt ggactgactg cgatctgttg gcgtggtttg acgcggcggc ggcagacgga       240
     gtcgcgctct tcgggcagca aagccgggac gagatccgcg ctttgacgca ggccaccgcc       300
     atggcgcgaa tgtgcgggga aggcgccaag gcgatctggg gactcgatgt acttggcccc       360
     ggggactatt cgccgatccc gacgagcatg aagcgcgtgc tgtgggccaa tgacctggtg       420
     tgcttcgggc cgcagctgac cgaggaacag accgcgcaga ttcaggccca cctggacgac       480
     gggcacgacg gtcatggccg gcaggaaacc aacgcaccag tggcagtgca cgggacggag       540
     tgtttcgcga cggtgtggat gggcggcacc gcgtag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page