(data stored in ACNUC1104 zone)

EMBL: CP001966.PE257

CP001966.PE257       Location/Qualifiers
FT   CDS_pept        270787..271530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76911"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76911.1"
FT                   /translation="MGTKQSTKKGPSYAEINEKLVRKAIVDNRGELARLDSTTAIREWF
FT                   DAWVATVDTEPQFVWKLFLRELNKGVGVNSAELWAKEQAEHRAQVAEAARVAPLLRVCT
FT                   AGFVGETPDGETVASWAICNAQADQSSRAYGEINPDKQKSYDPEDPNSADMVAAYKAVA
FT                   LLADAVGYLGGEAGVIRAQLVISNPNIDTDRLVSMALKDSVSLTVEHHEEADNPAVEVC
FT                   ETEVGERHWKDLAPRDFVIEGEQGQ"
     atgggaacga agcagagcac caagaagggt ccgtcgtacg cggagatcaa cgagaagctg        60
     gtgcggaagg cgatcgtcga caaccgtggt gagctcgccc ggctggattc gacgacggcg       120
     atccgggagt ggttcgacgc ctgggtagcg acggtggata ccgagccgca gttcgtgtgg       180
     aagctgtttc tgcgcgagct gaacaagggc gtgggcgtga actccgccga gctgtgggcc       240
     aaggagcagg ccgagcaccg agcgcaggta gccgaggcgg ccagggttgc gccgctactg       300
     cgggtgtgca ccgccgggtt cgtcggtgag accccagacg gtgagacggt cgcttcgtgg       360
     gcgatctgca acgcgcaggc cgatcagtcc tcgcgcgcgt acggcgagat caatccggat       420
     aagcagaaga gctacgaccc ggaggatccg aacagtgcgg acatggtcgc cgcgtacaag       480
     gcggtcgcgc tgctcgccga tgccgtcggg tatctgggcg gcgaggccgg ggtcattcgc       540
     gcgcagctgg tgatctcgaa cccgaacatc gacaccgacc ggctggtgtc gatggcgctc       600
     aaggattcgg tgtcgctgac ggtcgagcac cacgaggagg ccgacaaccc ggcggtcgag       660
     gtgtgcgaga ccgaggtggg ggagcggcat tggaaggatc tggcgccgcg ggacttcgtc       720
     atcgaaggcg agcagggcca gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page